Uname:Linux marissa.metanet.ch 4.18.0-553.141.2.lve.el7h.x86_64 #1 SMP Wed Jul 8 17:20:31 UTC 2026 x86_64

Base Dir : /home/httpd/vhosts/comeonline.ch/httpdocs

User : onlineadmin


403WebShell
403Webshell
Server IP : 80.74.154.100  /  Your IP : 216.73.217.0
Web Server : Apache
System : Linux marissa.metanet.ch 4.18.0-553.141.2.lve.el7h.x86_64 #1 SMP Wed Jul 8 17:20:31 UTC 2026 x86_64
User : onlineadmin ( 10487)
PHP Version : 8.5.7
Disable Function : opcache_get_status
MySQL : OFF  |  cURL : ON  |  WGET : OFF  |  Perl : OFF  |  Python : OFF  |  Sudo : OFF  |  Pkexec : OFF
Directory :  /home/httpd/vhosts/comeonline.ch/httpdocs/wp-content/languages/

Upload File :
current_dir [ Writeable ] document_root [ Writeable ]

 

Command :


[ Back ]     

Current File : /home/httpd/vhosts/comeonline.ch/httpdocs/wp-content/languages//tr_TR.mo
��9�M�#��/��S+�Y�Xم2�=A�	�������܆�� �/�4L���$����͇ه+�#�A�zM�
Ȉֈ�z��r�!��5��$�;�%K�q���&��'Ċ���8�dX�-�� �V�Tc�:��:�:.�:i���*Í�'
�L2�U�JՎS �t�9����,ȏH��8>�
w���	��
��"�� ɐ����
�	� $�
E�P�\�l�u���"��f��
�	$�.�2E�
x���������͒���.�Y=�1��(ɓ���/�F�3W�C���ϔ>V�����'�E�#]�������1�����8�)E�o���
��	��(��$ۗ��"�3�	;�	E�O�&o�����˘�����,�=�S�k�����	��ę'ۙ%�)�0�DP�'����
ʚo՚E�T�
`�k���������	��7��ޛz�f^�/Ŝ ��)��@�cӝ�7�X��j���m��N�A_�0��;ҡ8�6G�7~�G��<��O;�:��9ƣ��1��4ۤW�Rh�3��o��_�4��P1�@���ç:F�W��s٨PM�P��C�D3�-x�B��1�7�.S�h��^�eJ�~��/�"E�#h���#��7Э�&�!B�!d�3��,��.�-�!D�af�ȯ��1�!M�uo�"�!�
*�-8�`f�!DZ��%�;C�<�=��3��8.�g�4��2��4�/$�-T�b���'�;*�Rf�B��/��
,�,:�Ug�>��>��#;�%_���"��&Ʒ0�2�GQ�F���2��0�3�UQ�A��3�@�@^�0��.к/��U/�4��7��0�##�G�^�=v�E��g��vb�,ٽ �'�UC�)���þr���
������ſͿֿ���!"�D�M�Q�
^�l�	}�	������	�������������-�&:�0a���	���� ��
��	��(�:�
F�T�j�y�������O���%��,���++�W�r�!������	������������
�
�	�#�9�H�W�	k�u�	����&��'��&��	�)�?�1O�����U��R��L�-g�(��
����`��H�Z�c�t�=��P��1�-H�;v�?��*��,�;J�(��B��F��29�;l�N��<��O4�'��8��K��m1�H����*��S&�Pz�J������%��
�	*�,4�#a�Q��
����o�(r���������������P��J�S�Fk�,��8��1�+J�:v�!����_��%M�s���c��b��iW�i��"+�	N�X�(x� ���� ��� �r>�����������*�=�\�o�<��<��
����K%�q�~�#��
��������������%#�
I�2T�����(��#������*�;�T�7e�
��K������	���!�3'�h[�������.�,/�`\�B�����s/�%��������� �?�%^���������� �?�!\� ~�������#���8�&V�-}���!����&�-�1H�4z�2��2��)�??��"��-�����&�"<�!_�Y��7��9�M�
_�j�����/��	������:��=�T�[�g�t�>��F���'�U4�	����
��Y��Q�Z�`�g�s��������� ����1�"I�l�����=��&���P'�x����'��&��.��,�C�c���;��)���' �7H�;����K��?�_�5~�?��g��b\�������9��,�<�O�
W�5b���������	�����������,�8�E�"R�u�(������]��2�WC�3����������,�H�g�t�����[��O��
>�3I� }���
��������������u�@Z�������
�%�+�?�T�c�{���������
����!�6�
E�S�X�a�g�x����� ��� �;�W�o����������������,���>�����)�<�V�f�s���+��-��(	�2�J�Y�e�
n�:|����
�#���3�B�R�f�S��b�7Ld!�S�4�G,FtA�F�%Dj1�2�2�2[O
��1��63=7q$��&�
(0<mv:�������90V�2�7�LNf,��&�'�*(@i4}$�:�.	(A	(j	(�	5�	1�	$$
I
'e
�
�
G�
F
GQK��!4%$Z�,�)� 
&2
&Y
*�
2�
!�
 '3COk���!��
?/o�]�]�MR
b"m
����,�� @(Ox#���
`k
�������
�*�-+*Y0�&�$�-	/9
M
[fr�
���	����	��
���&5Lcx���
�
��
���	&
/:=F�����	"=KF���3��6�+�D�@#�,$L(q
��&���
��#6By!�����8$Pu�!�;� :BOR����v��}� m
!T{!�!�!"�"��"$�#��#:�$Y�$V4%)�%��%M&ok&�&/�&R*'}'�'
�'	�'<�'�'
�'

("(;(LA(�(%�( �( �())4)N)j)�)�)�)�)N�)C*cI*)�*,�*+	+2(+>[+>�+�+
�+�+
	,,
',	2,<,
Q,	_,i,	,�,�,	�,�,
�,�,	�,	�,�,-
--+-@-Y-
l-z-�-F�-�-D.L.b.
q..%�./�.�.	�.�.
�.
/ /
-/;/	B/L/X/g/t/{/�/�/�/�/�/!�/�/	0Z0>t0(�0/�0 1-1H1b1|1
�1�1�1.�1%212">2Na2�2
�2�26�2D"3(g3�32�3!�3&4++4"W42z4�4�4/�453
5A5J5 ]5~5p�5
66#626BF6�6�6�6M�6�657A7*\7!�7�7�7!�7�7>�7G68Z~8N�8(9H9%_9&�9!�9	�9�9�9�9
:
:
(:3:<:-H:v:�:�:�:�:�:�:�:	;$;
:;H;[;'l;�;
�;�;
�;
�;�;�;�;�;
<<#<	4<
><
I<W<
c<=n<�<7�<=m=6�=7�=,�=@)>j>�>�>�>;�>?	????#?	4?
>?^I?R�?@�?<@f�@$#A0HA+yA4�A�A�A�A�AvB{B�B�B'�B�B�B�B�B
CC2C"EC
hC!vC�C#�C�C�C�C:�C3D PD#qD�D2�D�D;E0=EnE�E1�E-�E�EF	F F	0F:F
?F9JFQ�F6�F3
GzAG\�G|H^�H=�H3IQI3fI3�I-�I"�IJ0J=JJJ3`J1�J5�J�J:KPKfKuuK�K�KLL$L	0L	:L	DL	NL	XL	bLlLsL7zL�L��L'�M�N��O��P�Q�Q
�Q
�Q�Q��Q�R�R�R*�RZ�RN/S~SW�S�S�S)�S"&TbITp�U*W�HXT�X3K\�]3w^��_	�`e�`#�`=a<[a0�a	�a[�a%/bUbqb�b�b>�b	�b�b"�b	c!c/&cVcuc�c
�c�c�c2�cdf6dy�dAeOYe��eYBff�f�g��gQ9hU�h��hQ�iH�iT-j��jBkLHk�k�k�k
�k�k	�k�k#l4)l^lql�l�l�l
�l�l�l�lmm.m>5mtm�m8�mE�m<nPnanzn�nC�n;�n
*o5oDGo;�o+�o�o
pp5pIp^popp�p�p�p�p�p�pqq%q7qDqQqgqq�q�q
�q�q�q�qI�qHr.Yr5�r��r�Bs�s�st�t�t �t�t�t�t
uu7uGIu�u�u�u�u�u�u
v!v<vUvmv�v
�v�v�vK�v w:wWwjww�w�w�w�w�w�wxx0xIx\xpx�x�x�x�x�x�x
yy2yHy`y
uyL�y)�y
�yzFz_zqz�z�z�z�z!�z{{L-{(z{(�{(�{$�{"|=|L|a|"g|�|`�|Q}7U}�}�}�}�}"�}#�}'�}&~.~G~/P~�~�~�~�~�~�~�~8�~80i|������
�
�	��	
��$�5�>�F�M�
]�h�}�+��Ȁ
؀������J�KY�F��G�G4�H|�CłE	�HO�J��4�P�Ni�;��S�4H�=}�W��*�5>�Jt�8��7��;0�:l�!��8ɇ6�:9�Nt�9Èt��hr�5ۉ3�:E�8��)��6�A�.\�-��1��)��*5�0`�������
��ÌˌԌ	������:�I�V�b�
q�|���������Í	׍5�2�	J�
T�_�n�{���@��$�	�$�9�@�H�O�_�y�T��֏�&�*�	/��9�SŐ\�Vv�͑
ґ��
����&�6�C�S�
d�r�~���������
˒ ֒��5�<�S�q�u���
��
����#��ړ
���
�!�(�A�Y�x�1��Ȕ	͔
ה�	�����%�5�G�c�x���7�����:x�2��������#&�$J�Wo�TǗ�#%�I�<i��� ��&Θ�����$�A�Z�:n�5��%ߙ�	��!�	'�
1�?�S�e�
|�����
��Ś͚ٚ0�c������1��%ě"�-
�q;�K��#��
�(�9�I�^�t������� ͝�5�D7�|�
����?��:�.'�V�j�~�
������̟՟�����!�S;���������Iՠ�=�J�e�t���2��8ӡ�8,�&e�����
��Ȣע���	�	��	%�/�	A�	K�.U������6�N�9Z� ����"Ϥ���.�
@�N�3c�����ե����9�N�a�s�����,�������$�5�P�l�-����=§��)�?�\�x�����;����H�N�7`�/��ȩ��!��!� :�[�x�&��/��(�&�3�!E�g�!y�����ʫ	ϫ٫
��$�))�S�j���
������'������2�R�'k���
����'������
�4&�[�j�y����
�%�1�c=����� ����'��H��!���F&�m�����	����ԱQݱ/�K�d�k�-q�����ղ��$�)�	2�<�iK�������
ųӳ��
�
�"�
1�
?�J�d�t���
��
��
��ô
ɴԴ�
�	���
��.�F�S�i�z���[��U�W�`�o�'����+ȶ	���,�F�L�
h�lv����� -�N�f�"~���!��ٸ���(�C�V�v� ��
����2Ϲ��O�`�o� ��
��
��ɺ
Ѻߺ�@��	<�F�K�P�@b�,��7лN�*W�������Ѽ!�#�0�K�+˽��C�2P�+����7̾H�M�A_�+��_Ϳ -�N�$`���������
����
������)�;�W�r��������������*�B�R�l�|���
��>��#��
�
#�1�8�E�
K�V�
b�m���
����������������4�O�
`�
n�|�
������������O��"�+.�oZ�x��C�@`�
��T���Q�(]�O��'��K��J� h���������	��S��1�!8�
Z�-e�N�� ����"��!��&��)��.�M�
Q�\�e�r�������,��3�	E�O��\�'��<�Y�i�v�5������������#�[5�1���������&�D�X�e�q�����L������	��2�B�Z�n�
v�
��
������:��6�6<�s�������	�����������%�8�H>�����	�q��
�%&�L�	U�6_���+��0��
���3�<�E�Y�fh����V�	Z�d�m�r�#z�+����-���#�:�N�g�k�t�����
��
��0��M��7�=�LD�	��S��M��*=�Qh�\���(�/�A�S�j�|�����������#���!�7�H�W�s���7������$��
�)�>�7G����s���	!�+�
;�F�S�i�v���������
��
��(����
��#�0�<�P�]�'t���	������=��D!�f�u�	��*��2��������-�B�T�5g�����!�� ����7�	N�X�]�{�����������������
�
#�1�B�R�m���
����������������
�����	1�
;�I�X�
w�����
����	������
��
��R
�@]�!����$��
�� �=�"C�f�
k�y�����	��3����1���
�)�,:�(g�.��A��)�.+� Z�{�=��6���%�E:�6����(��*��)*� T�u�$��$��)��(�%0�%V�%|�%��%�����$��-��+��'�=-�:k�6��0��3�DB�@��4��6��<4�/q�3��-��H�KL�<��8��/�9>�Gx�6��B��B:�3}�C��<��I2�/|�9��8��P�8p�E��<��A,�2n�5��I��;!�<]�?��3�2�/A�/q�3��/�/�&5�5\�A��,�)�;+�)g�6��:�7�>;�=z�0��5�-�-M�-{�-��)�0�32�Bf�9��3�3�;K�G��)�0��;*�If�1��5�;�3T�<��1�:��<2�<o�0��-�29>>x9�0�0"<S7�7�;=<=z0�(�-8@+y8�8�4:L.�2�)�:7N4�K�A8I*�5�-��'�`�&COjI�(	-	%6	$\	"�	"�	"�	�	�	�	
0
<
D
V
Xg
�
�
�
�
�
&-K
^lr
����
��	�0�#'.?KS[cy��	����1�	

!
	(
2
6
%=
=c
	�
�
$�
 �
�

!0B�R�0Hh������5Pk�V�5�/4F{��,��	04?t�#���-�	F22y�.�1�
Db�+�*�l��XfXg�'FA�#�M�g1|��%oD�+�<OCM�-�.9>;x.�<�^ \f�WC3�'�0�+(#TKxG����T�^+ � &
!21!4d!$�!c�!1"""T"&w"&�"�"3�"&#%9#4_#$�#"�#&�#$% $*F$=q$7�$0�$3%9L%��%C&,O&"|&t�&�'*�'7�'�(X�(=)8\)�)7�)�)*'*aC*a�*#+]++0�+�+�+/�+=!,_,P},D�,>-DR-*�-<�-?�-8?.;x.5�.H�.K3/H/;�/I0YN0�0�0�0"�0#1U=1:�1L�12/+2[21k2*�2+�2B�2y73q�3'#43K4-4�4%�4F�4-5:L5%�5@�5?�5@.6Po6��6}7�7+�7,�79
8*G89r8(�8'�8?�85=94s95�9@�9':&G:}n:��:Er;/�;+�;;<,P<<}<(�<8�<0=@M=,�=<�=@�=C9>)}>(�>N�>%?"E?Nh?�?8�?K@�Z@9�@i+A�AZ�AB%BP?B6�B1�B.�B=(C?fC#�Cm�C28DHkDS�DKE*TEEC�E/�E,FO9F$�F%�F'�F�FG7GGGVGuG)�GM�GEH"HHkH"�H-�Hi�H.EI#tIa�I �I0J/LJ |J�JF�J&K7'K=_K!�K(�K%�KL+LJLjL>�L4�L+�L>!M0`M0�M.�M��M�N2�N�N0�N0OYJO1�OG�OPB2P-uPT�P6�P/Q?Q[Q!pQ�Q�Q,�Q0�QR6R)NRxR�R-�R�R�R#S$SASRSmS�S#�S�S7�S"T@Ty�T!:UO\UI�Ul�UGcV#�V9�V5	W>?W2~W1�Wo�WXSX�X�X4�X#Y"5Y XY$yYD�Y�Y�YfZb�Z_�ZvI[/�[��["�\"�\;]@]%V][|]��]k\^+�^-�^"_?_R_n_�_�__�_M`2]`m�`<�`0;aIla\�ab+2b+^bx�b(c,cJc^bcd�c<&dcd&�d��dB9e|e�e4�e2�e6fVfIhf4�f/�f(g*@gkg-�g(�g-�g(h.hKh;gh��h*iKCi�i�i�i�i�i9jWNjC�j%�j.k3?k-sk��k7Hl�l�l�lw�l8=m?vm<�m5�m<)n*fn)�n��nqJo>�o9�o 5pVpjp
pp~p"�p�p%�p(�pq%0qVqtq�q�q �q�qr(rGr er�r�r�r�r�rs>4s(ss�s�s%�s"�sA tbt�t�!uk�uEv�cv�v�w�wA�wx$xP+x"|x%�x'�xV�x�Dy0,z�]z�{,�{w�{vT|V�|\"}e}5�}4~,P~0}~5�~I�~A.Ap*�I�`'�3��D��X��Z�#��P�'p����=z�e��0�'O�.w����<)�)f�"��L��f�9g���"��܆+\�c����>̈'�E3��y�L$�)q�i��!�"'�J�2ʋ8��A6�&x�K��#�[��k��K��̎i�	m�w�����������ŏ	я�ۏs���������͐ߐ���,�?�Q�W�Dg�3��1�5�H�%]�����%��ђ�ؒ���K�Ge���4-�2b�����G��+�?,�l�����������	��	����AҖ��(�K��E�R�V�^�p�x�������
��Ϙ�#����D:����(��*ʙ���5�I�g�}�$����uƚ<�D�	H�ER�)��N›�.,�[�v�(��2��1�)�0I�Fz�2��=�2�TO�7��!ܞ-��,�
E�1P�A��
ğҟX�
A�L�	U�_�*d����+�"=�%`�"��*��$ԡ1��!+�M�#m�����!Ѣ'�$�"@�%c�%��(��أ��8�D�W� ^�A�1��1�C%�i�����������
̥ץ
�4��/�E�
T�_�u�~�����ͦܦ
���|�{��~���� ����Ш���0,�	]�wg�=ߩ3�Q�Wa���6ɪW�4X���K��W�L�U�
Z�e�x���
��������ͬݬ
����
�,�/5�e�"|�"��­6ح2�$B�g��������!̮�k	�u�������.̯'��#�	=�G�?T���2��kͰ9�<?�|���5��9бB
�UM�����K����#�
B�P�a�s��
������
��Ƴճ�	��
���
2�	@�
J�U�
^�l�	�����	����Ĵ̴
��
��e
�Ep�H��/��C/�>s���&���	��������Y�Vw�VθV%�V|�jӹi>�K��L�[A����s,����a-�����:�"�O.�&~�5��Bۿe�(��0��+�A
�-L�&z�4��+�2�15�2g�<��?��J�1b�3��<��1�17�Ai�6��+��4�)C�-m�,��3��Z��)W�7��.��D��2-�7`�2��W��:#�+^�,��*��K��=.�<l�0��&��D�AF�J��I��J�:h�{���%�<�N�"^�+�������E=���5��(������4�G�W�g�v�S������t���
2�$@�e�	z���+������������i���D�~��GD�#����;��C�DD�0��<����5� D�e�0}����,k����~&�+��(��,��-'��U�+���� �����Ep���9��K�6X�*��&��7��<�*V�#��I���������H�_5����g�]~�����
� ��@�$��p��d]�)�����M�Wc���e��G?�j��$��'�Z?����-J�Vx�����x�Q�Kg�V��?
��J�#�=�[�r������������%�8�W�'j� ����������0�)?�i�	��T������������$�A�]�y�����������:�S�l�������������#���'(�P�p�����������	��2�4I�R~�U��:'�9b�e��4�G7�3�(��<��B�X\�J��o��p����3~�Q��w��|�s�ey�N�_.�W����W����R��(�7�*>�.i�B��>�;�2V�1��2��F�n5�K��X�<I6�I�<<Dl�&�*A@Y�F��#8�J�A>=�d�a#?�5�:�D6O{A�7
AE��8?_x4�=
	<K	8�	P�	w
.�
L�
6o=I�2�3*O^%�=�S
�f
�
JT]5�E�G.'v,�_�G+'s"���QF3�:�EMcv������(Hb{������#9Wh{������-B\o������(ASg|������5Mf}������ 3Jcw������"9Vp�����)D`u�����.CWh{����!>Sn��!��"&AUg������$8J^t������
#4M^$u����� ( ? U i �  � � � � !!!7!N!f!~!�!�!�!�!�!�!"$";"S"l""�"�"�"�"�"	##9#P#%h#�#�#�#�#�#�#$$'2$
Z$"e$"�$�$�$�$�$�$%+%"H%k%�%1�%%�%!�%& 8&Y&'y&/�&#�&"�&''4'P'l'�'�'�'�'�'�'((-(?(Q(c(x(�(�(�(�(�()%)!9)@[)+�)*�)B�)96*p*v*�*�*�*�*
�*
�*�*�*++%+'8+`+Lt+N�+G,JX,i�,F
-LT-B�-D�-).F.$].c�.@�.E'/@m/R�/809:0%t0�06�0�01181N1e1y1�1�1�1�1�1�12,2@2Y2r2�2�2�2�2�2�233;3T3s3�3�3�3�3�3�3	4444L4`4q4�4�4�4�4�4�4�4�4
5505F5V5h5�5�5�5�5�5�5�56636H6Y6h6{6�6�6�6�6�6�6�67+7@7Q7c7u7�7�7�7�7�7�74�72'8
Z8e8-w85�8.�8i
9lt9`�9bB:.�:i�:l>;.�;i�;lD<.�<i�<lJ= �=G�=G >h>%�>�>�>�>�>�>?&?=?O?f?P}?�?�?�?@ %@F@b@^~@m�@!KAmA5�A/�A-�A B?BSB7lB3�B3�B2C)?C%iC%�C$�C�C�C	D D-D
DDODwD�D�D'�D&�DE"E")ELE`E{E�E�E�E�E+�E"F;FWFnF$�F�F�F�F�F�FG'G ;G\G|G#�G �G�G H""H EHfHH�H�H�H�H�H(�H! I$BIgI'�I�I�I�I%J ,J!MJ'oJ�J�J�J �J%K#8K\K
{K�K�K�K�K�KL#L:LOL&XL'L)�L(�L(�L(#M+LM(xM)�M(�M%�M)N'DN+lN'�N*�N'�N)O*=O(hO%�O)�O%�O)P'1P'YP(�P*�P'�P)�P''Q+OQ&{Q)�Q+�Q(�Q)!R(KR'tR'�R'�R(�R#S&9S)`S*�S"�S%�S(�S'T9TKTaTjTT�T#�T �T�T�TU*U:U IU(jU�U�U'�U�U"V&4V[VuV�V%�V�V�V\�ViOWb�WX.X;XKX]XpX�X
�X�X�X�X�X�X�XYY$Y5YOY
\Y
gYrY%~Y�Y�Y�Y��YZ%�[>�[V�[`G\a�\
]?]	]]g] �]�]�]�]�]^(&^=O^�^$�^�^�^+�^;_<O_�_{�_`
!`,`�>`�`"�`3a)7aBaa7�a�a&�a7b-Nb|b&�b�b�bn�bKdc,�ce�ckCdA�d@�d@2e@se)�e5�e+f7@fYxfo�f_Bgu�ghN$hsh-�h7�hJ�h
4i?i	Li
Vi1ai+�i�i�i�i	�i�i#�i	j
(j6jFjNj
]j%kja�j�jkk)"kLkakwk�k�k�k�k�k1�kNl@_l2�l�l�l*�l)mO9mP�m��m=�n��n�o!�o�o6�op&p6pJGp�p�p?�p5�p(q<qPq`q%hq0�q�q�q�q�q	�q	rr1r&Prwr(�r�r�r�r�r�rs$s$=sbs�s�s�s.�s3�s
t.*tMYt#�t
�t�tz�tcusuu�u�u�u�u�u�u:�u
v�v��vG6w$~w=�w��wdvx�xh�y�Pz�{z�{OD|P�|;�|B!}:d}0�}9�}C
~KN~T�~5�~.%�T+�*4�p_�IЀ6�`Q����4\�R��F��+�>��a���_����x�S�\W�2��Y�+A�3m�*���̇�Y�^��A�� ��$�'A�)i�U�����%�<�9Z�>��<Ӌ@�4Q����"�.�N�Bi�(��sՍ I�/j���'��lԎA�"_�(��#��0Ϗ<�6=�*t�1��"ѐ8�0-�:^�0��5ʑj�k�*��E��o��Hg�*��ۓ,�q�D��?ϔ)�$9�"^�'��2��7ܕ6�UK�V����2�J�'M�Iu�C��9�K=�R��;ܘ1�7J�e��>�9'�#a�����ĚE�B&�\i�tƛ(;�$d���d��,��;���)�:�B�
V�a�n� ����
ž%͞���
��)�D�	Q�[�k�
��������
͟
؟
������10�:b���
��!��%ݠ��
,�:�U�e�r���
����¡ߡ�`	�j�r��{�x��%����֣"�
	��	+�5�
G�R�Y�`�
g�r�~���������
Ҥ
�
���*�76�;n�
��9���4�	;�"E�th�sݦ$Q�*v�/��ѧ$��
�������ʨEܨk"�/��0��C�D3�'x�4��Aժ/�BG�S��+ޫG
�hR�?��T��-P�Q~�ZЭx+�T����,
�X:�^��P��C�
�1�I�e�1l�3��Vұ
)�4�rT�&Dz�
����
��.�PF�	����K��:�BF�3��-��M�'9�;a�w���5�	T�^�~޶y]�v׷.N�}�������
����˸
׸{�a�y�!������Թ����1�KB�T�����Y�n�
}�%��
����ϻ�������# �	D�8N�����(�� ּ����+�>�J�0Z���a��
����!�'�0�/5�we�
ݾ�"��& �3G�|{�A��:�K�Z�ru�*�
��	7�A�E�
N�Y�	k�
u�������
��������	��
����(�0)�Z�
a�o���	���� ����"���B6�y�'��.������$�'�)G�rq�5��9�T�h�$q�����E��
������B	�HL���������Z��o�
��5��X���'�4�nE�Q���	�!�2�O�X�v���"��������$�=�\�u�^��2��"�\)�������#��'��:�:>�y���$��I��1&�$X�$}�A��N��3�PL�?��0��>�>M�u��m� p���	��6�����	�%�1�5�F�a�p�
����
���������������($� M�Bn�
�������[�nv�E��+�2�N�
b�m�1z�'����	������{�r}���;�� 9�Z�b�v�����	��
��^��%�15�*g�)��*�������%� :�[�p������������#�B�^�q�}�������������������.�
I�T�f�l�t�{�	�����U�Ct���F��
� �4�P�)i���������5��6�?�Q�2U���������A�����*�-9�g�y� ��������U���P������(-�SV�-��h��gA�V��g�(h�%��B��F��FA�B��d��0�@�2T���0��2��2��)'�Q�!f�	��(��?�����=�V�k�����������F��9�O�8i�:��`��>�U�=u����� ��.�!?�a�;s���E��#� 7�X� x�*��4��!���23�f���Q��M��H?�M����(��.�!I�+k�!��)��&��
�&(�&O�.v�5��!������$�3�
G�U�!p�����#��9��#�@�P�Qo���
�����we�����2
�=�M�c�s�+����� ��$�-�(K��t�	���
�
-�8�M�^�r�x���2��
�4�>�AB�3��-��=�$�1�J�[�k�z�������������
�
�������.�:�M�Y�w��������
������� &�G�P�
W�:b��� ������+�J�d�Lt�����,�
�@ � a�
�����![*}#�:�$AP
ju{�,�R�# *D#o �%�&�	)'5!]'N��:I�cZ��Y�����4o�k.	!�	#�	�	��	��
)���=��
q�
4�J!��� {=�N�):MVA_�����M�8DJV�;�1"Tdw��
�
��^�-w9A�>�2*;EfS�STk� ����"4Pbs�������);Uu�� �(�j$yj�%	/K^!f/������
3	@JVfu�
����#�)�5~PW�C'Ok#�#�"(B
ky�>�5�4,ba��0�U_u4�.
 I9 #� 1� *� 4!Q9!	�!�!A�!�!/�!
,"7"<O"�"��"(#/#N#g#Aw#�#	�#�#c�#1$JC$�$$�$,�$�$�$2%
3%DA%L�%m�%wA&.�&�&!'-#'#Q'
u'�'�'�'�'
�'
�'	�'�'0(6(V(l(~(�(�(�(�("�())'););M)�)
�)�)
�)�)�)�)*�)*%*<*P*d*v*�*�*�*C�*&+:(+!c+��+E,JU,B�,g�,K-X-`-e-Mn-
�-	�-�-�-�-�-�-	�-l�-vg.>�.�/|�/-%05S0D�06�0
111(1�.1�1�1�16�12%262E2Y2t2�2/�2�2/�23$#3H3	Y3c3z3�3�3�3�32�3'41A4,s4
�4
�4 �4$�45555.5B5G5LS5X�5D�5F>6��6|7��7}18M�8�89C%9Oi91�9�9:
:::G,:Ht:H�:;Y$;"~;
�;��;O<c<v<�<�<
�<
�<
�<
�<
�<
�<	�<
�<A	=K=S=zV>U�?'A;B<CBC^CmC}C��C>DEDUD5oDy�DpE�EY�E
�EF.
F(9F�bF��G&�I��J�Kg�O/QU8R��S�T~�T,UU<UZ�UR�U@VnHV6�V,�VW7WKWQiW�W�W�W
�WX2X&9X$`X!�X�X�X�X:�X$Yy+Y{�YX!Z>zZ��Zjq[_�[�<\��\S�]`�]�^^I:_F�_c�_/`;aOCa�a �a�a�a �a	bb-*bGXb�b�b(�bcc2cDcXc!nc�c�c
�cX�c.dId<YdD�d5�de+e(EeneZe?�ef&fD<fU�f-�fgg9gRgfgzg
�g�g�g�g�g�g
�g�ghh/h
Ch
NhYhnh�h�h�h
�h�h�h�hT
i_i*ni8�i��i�[j�jk	$ky.k$�k(�k�k&l-l>l#Vlzl^�l�lm#m=mTm dm�m!�m�m�m�mn n1n.KnZzn�n$�no2oLo%_o�o�o�o�o�o�op/pJp_pwp�p �p�p�p�pq)q%:q`q~q�q�qf�q3)r]rvrO�r�r�r%s9sSsis0�s�s$�sS�s(Ot%xt%�t'�t#�tu"u
=u'Hu"pu��uLv.ev
�v�v
�v�v$�v(�v&w9w>wBwNJw�w�w�w�w�w(�w�wBx?Jx�x�x�x�x�x�x"�x#�xy/y	ByLy	eyoy�y�y�y	�y�y�y'�y5zE8z~z�z�z�z�z�z_�za({`�{^�{aJ|T�|W}XY}[�}]~Hl~g�~hN�r�WH�X��q��3k�O��h�PX�J��Y�UN�7��P܃L-�Uz�dЄM5�����<�NކF-�[t�MЇ;�LZ�j��H�P[�I��F��1=�<o�A��
����0�F�Z�o�����
��
��Ƌڋ��#�:�Y�u�
������
��U��5�I�\�
e�s�����?��2��$+�P�
l�
w�
���� ��	юwێS�"m�3��ďɏ�ЏW��d�hT���őב	���	��
�$�6�O�a�r���������ВՒْ,��%�94�%n�,����ȓ̓Փ���)�1�
:�H�Z�t�'y���'��&�D�T�Z�g�t�
������
��ĕە �"�16�!h�E��Ж�ٖ9r�?���
��	'�1�!F�"h�g��c�W�!d�"��@���"�(�;�B�Q�g�p���K��B�'/�W�	[�e�g�j�y�������	՛ߛ���!�1�B�8I�����	� �#�'�/�82��k�S�1\���������Ϟ��$�6�"P�s�)��a��'�:�J�C^�<��9ߠ�.�J�]�t���
����
ϡ
ڡ�
��P �q�����"��Hɢ�
.�9�R�i�%u�=��!٣!��#�0A�r�����
��ʤ�����
+�9�
O�
]�(k����������4��#��20�*c���!��&����T�*\�3����ڨ� ��?�X�d�"������;ѩ!
�!/�
Q�\�{�����&תH��G�Rg���ګ!�*�:�Z�$m���?���O
� Z�;{�=��(��
�)�3=�+q�$��)®�4�>6�,u�+��ί"��//�#_�����	��%��ϰ<�4�R�k���������4��!ձ��&�!8�!Z�(|�����ɲ6ϲ�
�&�+�7/�
g�u������4�C�R�y^�
ش�!����-��]*�'��	��	��ĶǶڶ��� �h1�)��ķ�	�<��2�:�Q�b�n�+����
¸͸�޸h�k�q�z�����*��ڹ���

�� +�L�"`���������Ժ
ݺ�	�	
��	 �
*�8�G�^�j�
��
�������q:�����-ļ+��5/�e�m�)����4�����%��%��(ܾ3�9�R�$m���&��!ؿ ���"/�R�(e���$��
��2�#�*�k3���.��'��!�9�A�J�Z�Es���������M��4<�Pq�v��)9�$c���$��$��+��+�#H��l�*�@�h_�<��<�)B�Hl�d���?3�;s�i��&�@�U�
p�{�#����
����������
��+�;�S�h�������������
�������������� �%�"9�\�p�?��$�������-�6� H�
i�w�������"������
��",� O�#p���
��
����
��������	��K �	l�<v�����8�*��N��
A�`O���u��@5�uv�@��j-�2��)��'���1�:�O�]^���'����?��a9������!!�%C�2i�.��:���
��#�(6�(_�+��-����?��5�D��V�2�[6�������C��	�%(�
N�	Y�	c�m���q��9�#?�$c�
������&��������4�
O�m]���(��"�'�E�b���
����������+��K�IQ�P����
��%�	C� M�n����������[���1�������0�1I�{�
��Q��#��A�MF���������
������j��n�� �
-�	;�E�%L�7r�"��0����)
�4�J�j�	n�x�z�������:��s��
i�t�p����[��FY�G��[��sD������������.�C�R�	g�q���(����������
�	)�3�UN�����(�����	�:�&L�s������.�>�J�W�
u�	����������
����)��
�
�
)�4�C�O�f�s�1��'��������K��LI�������'��B��6�>�E�K�
R�]�#d�K������4��B4�w�y�{�}���>����(��"�:�*Z�(������$��
�� 4�!U� w�"������	����������/�->�l���
��
��"��
����
����
��,�">�
a�o�k|�F��/�O�+m�����)��� �
��#�3�	I�S�E_�
��A������
�3!�-U�-��=��=�6-�d�#��Y��C�#F�#j�`��J�.:�8i�5��2� �%,�7R�4��(��'�%�6�$V�){�*����(��7��3�;�?S�@��;�8�8I�?��:�9��97Fq5�6�/%PUW�<�5;*q5�A�7WLW�1�L.1{O�0�8.>gU�A�D>I�8�38:Ms6�;�94.n'�,�,�-	*M	2x	%�	3�	O
0U
0�
E�
0�
B.Gq8�C�>6/u6�1�1
/@
7p
6�
=�
-PKH�=�7#2[Q�5�/HFP�3�5;J7�E�0<5>rJ�0�1-1_5�E�5
1C5uF�@�:3=n7�9�**I0tG�1�34S6�N�9=H3�D�B�7BQzG�@3U:�5��3��20�e�cQ<��.�.*.Y0�4���&(<LXgT}����  0 !6 X k z � � � "� � � � 	!0!F!J!P!
R!]!d!
q!|!�!�!�!
�!	�!�!	�!="D"S"l"x"	"�"9�"O�"#+#3#R#r#�#�#�#�#��#�$
�$�$�$
�$	�$�$
�$�$�$%%-%<%N%*_%X�%9�%&6:&q&�&%�&)�&�&
'0'?N'�'�' �'�''�'?(Z(l(S(O�(#).))1X)�)G�)�)�)*<*AY*h�*+a,c~,*�,O
-]- y-_�-a�-2\.��.,h/A�/+�/H0SL0O�05�00&17W1C�16�1C
2fN2i�2�3l�3D
4 R46s46�4"�4Q5JV5��5"P6s6X�6��6�p7&82/87b8'�8x�8+;9g9�9 �9�94�9): @:3a:!�:"�:#�:�:/;.L;8{;6�;;�;9'<6a<��<G7=3= �=j�=�?>,�>+?�D?^@3f@G�@�@0�@*A=A&WA�~A�B!�Bi�B3COCiC0~C?�C�Cv	DL�DF�DME7bEH�ER�E>6FAuF;�FO�FRCGL�GB�GM&H�tH�HI!I9I#VI^zI?�IHJ
bJ2pJ�J:�J%�J%K>>K�}K�	L%�L>�L;�L7M.FMIuM�MP�M!N?6N5vN1�Nb�NAOCPXP$mP$�P2�P&�P9Q7KQ0�Q7�QJ�Q97RNqRT�R1S0GS�xS��SU�T)�T*U2JU1}U;�U-�U4V0NV<V-�V9�V;$WL`W �W&�Wq�WgX�X<�X'�X<
YNGY��Y;[Z^�Z�ZS[j[|[B�[9�[;\/G\Dw\�\.�\�]/�]G�]Q	^N[^,�^�^M�^28_#k_]�_�_
`.(`$W`|`�`�`$�`�` �`G
aORa(�a�a;�a,%b~Rb8�b
cz#c.�c=�c<d!HdjdQ{d+�d?�dE9ee+�e�e�e�ef*fE9f:f6�fS�f<EgC�g/�g��g�h2�hi'(iPiani.�iH�iHj4]j?�jC�j)k@k"Pksk#�k�k�k&�kE�k"=l`l ~l�l�l5�lmm).mXm
nm|m�m�m1�m�mPnTnpnnm�n$MoaroS�op(p\�p�p1q5@qVvqE�q4r]Hrg�rs)s3;sos�s�s�s;�s#t9tkYtn�tZ4uk�u.�u�*v%w%4wDZw�w#�wR�w�'x^�x-/y/]y�y�y#�y�y�y	zkzM�z%�zq�zKp{/�{9�{]&|�|)�|*�|��|&�}"�}�}[�}l:~A�~�~�~�f��-�7E�7}�9���f�0k�D�� �9�<�'K�;s�-��A݂�$<�Ma�n���T5�������Մ!�G
�QU�Q��+��(%�*N�%y����D"�g�}������@3�Dt�8��7�9*�.d�.���‰�d�@�K,�#x�������ʋ݋��
��4�A�S�	Y�c�h�o�
{�����	��
��������	Ōό	،&�	��	#�-�:�%G�
m��{���k؎D��L�؏�ݏa�>i�����`��'!�*I�'t�Z�����#����vʓ*A�il��֔Xs�^̕f+�,��?��5��65�0l�J��I�R2�0��G�����5��T��e��q��^2�%�����:x����/M�/}�>����B��+Ǟ�@�zR�Q͟�#8��\�5�p$����4d�,��QƢ��Xޣ/7�pg� ؤ$����.��4ӥ<�(E�Fn���uԦIJ������ĩȩ٩��	�� �&�3�@��L��	
�� �
-�8�A�G�N�S�Y�
b�m�v�B��3ϫ4�48�m�������%��	�����f��G��V�2�0'�X�2_�[��:�W)�������ıͱұ	۱��Q�X��p�KP�
������������γӳ�� �
0�0>�o�u�A��ϴߴ4��3,�!`�#��
��/������,��>�	߶�	�_��*W�V��ٷ/�!�=�*V�8��G��4�G7�K�4˹2�3�UM�B��)�=�#N�r�/��P����t%���
����ü/˼~��)z���ý�)��'%�'M�u�����%ƾ#�(�(9�*b�!��!��'ѿ1��+�=�N�Sg�����T��8K�<��V���6�C�	Y�c�'x�������@��+�K�^�o���������
�������'�����B�
��������6�"N�q��������X/�B����`��A�=\�k��C�J�aj�p��=�X�d�$|���&������/� G�h���"��������/�;�HO� ����F��I �2j�	����������.�������� ������,�;E�%������P���V.�r����;��;�C�BW�D��Q��[1�
����K������)�8�H�Z�o���	����!���� ��
� ,�M�c�{�����������	�#�C�!_�������
��������
��X��A��=,�Wj�J��
�"�A�
F�Q��T�5�A� X�\y�\��\3�\��b��uP����HH�Y��h���T�~���{�n%�����I�'F�dn�-��,�P.�x�)��H"�?k�>��,��0�2H�8{�=��E��78�Xp�P��X�3s�3��N��2*�.]�H��M��?#�<c�;��K��@(�Oi�p��0*�6[�4��d��V,�Q��D��y�J��2��(�(;�Rd�k��r#�C��1��V�Mc�X��F
�]Q�_������������%��-�F��R�D��	$�?.�n�t��������������\2����������
�+���4�)G�q�w�|���
����������jI�&���H��JB�J��)�0�!3�9U� ����8����K���}��?4�:t�F��C���:�9�E���b�%�?MX1�8�5CGR�?�.GM���HV#�zr	pv	�	

1*
�\
 �
f
ft#�!�!P4e��s
Uy
��
 d �]��/�d��]��L�E�b"K�"�"�7Li|!��#�$�!#8\4x)��&�5+N.z��r�E
NY
`k
t��������
���
�����	&=L`ox����� �t�IA=� �Y�4DGy)�!�5
8CV|B�`�w���A�o��]��wo ?� M'!Pu!��!gf"��"A�#�#*�#!$)6$K`$5�$.�$-%*?%8j%O�%v�%<j&L�&H�&.='Sl'-�'9�'{((�(#�(0�(a)<q)��):i*G�*>�*<++nh+^�+96,&p,8�,,�,]�,=[-5�-*�-��-5�.Q�.6Q/?�/5�/6�/U50��0!1J214}1��1242;g2%�2>�237!3YY3��3P4Sa4U�4-5295Gl5 �59�5W64g6�6�6��6SC7.�75�7 �78$8)82878?8P8\8b8h8t8
�8
�8
�8�8�8�8�8�8�8�8�8�8�8�8�8
�899
9
9*909	=9G9	X9b9h9m9t9
|9�9�9�9�9	�9�9	�9�9�9�9�9�9�9:::*:1:=:U:\:d:l:p:v:�:�:	�:�:�:�:�:�:	�:�:�:�:�:�:;
;;
.;9;>;	O;
Y;g;p;�;�;	�;�;"�;�;
�;�;�;
<
<<$<+</<	6<@<S<c<p<�<�<�<�<�<�<�<=*=:=Q=f=o=
u=�=�=�=�=�=�=�=	�=�=�=�=�=>>>!>
.><>B>O>	`>j>
y>�>�>
�>
�>
�>
�>�>�>	????0?6?R?a?q?
�?�?�?�?�?�?�?�?�?
�?	@
@
@$@5@H@]@	i@s@
y@�@�@�@
�@�@�@�@%�@
A,A5ADAJAWA	fApA	�A�A�A�A�A�A�A�A�A�A	�A�A	B

BB
 B.B4B:B>BDBLBTBXBkBwBB�B�B�B�B�B�B�B	�B�B�B�B�BC
CC+C?CPCXC	dC
nCyCCC�C)�C)�CE$DEjD�D�D�D�D�D�D�D�D�D�D�D�D�DEELENdEG�EJ�EiFFF�FL�FBDGD�G�G�G$Hc(H@�HE�H@IRTI8�I9�I%J@J6ZJ�J�J�J�J�J
�J�J�J�JKKK'K8KEKLK
[KfKlKuK|K
�K
�K�K�K�K�K�K	�K�KLLL%L
.L9L@L
ML[L`LeLkLqLxL}L�L�L�L�L�L�L�L�L�L
�L
�L�L�L�L�LM
MMM'M6M?MCM
JMXM\MdMkMsMzM
�M
�M�M�M	�M�M
�M�M�M�M�M�M�M�MNNNN!N*N3NLNgNtN�N�N�N
�N�N�N
�N�NOOO1OJOROZOmOuO�O
�O�O�O�O�O
�O)�O�OPP&P
,P7PMPg\PZ�PQ<Q3PQ�Q�Q�Q�Q�Q�Q�Q�Q�QR)R=RQRfR�R�R�R�R�R�R�R�R�R�R
�R�RSSSS%0S$VS*{S�S�S�S�S�S�S�STT"T%T%BT$hT*�T�T	�T
�T�T	�T	�T
�T
�TUUU#U*U
1U?UEURU^U
fUqU�U�U�U�U�U�U�U
�U�U�U
VVVV$V6V>VFV NVoV
{V�V�V�V
�V�V�V�V�V�VWWW
W'W/W8W@WEWNW
UW`WgWpWwW	�W�W
�W�W�W�W�W�W�W	�W�W�W�W�WX	X
XX%X#.XRXYX`XgXoXrXxX	�X�X�X�X�X�X�X�X�X�X�X�X�X	�X�X�XYYY"Y	5Y?YHYYY
`YnY	rY|Y
�Y�Y�Y�Y^�YnZhZ�Z
[[[![2[B[I[K[N[Q[T[W[Z[][`[c[�[	�[�[�[�[�[�[�[�[��[j���D�<�x��Iu�
��1��P
*�N-T�w
�`�'�P��2	ie�
T
v�	#���d<�	�����~�.�	�	����/�D
�	�m��
�`����AL�~�=��G�����
�8���
#m�	����A���l;���	��	�
{�EK�z�
���<	��F�H�Z��	\s��O(	��
p����C��!w����3gg�
L��
,<_�
K
F[h
|
����Kd�1j��?���
}�=
��u�
&E��������'	���
�>�i�
s7!v��
�.z8�%
}rp�$]�a��(`e�����#	�
��
���	���AO*	�.�qm���u��[	 V�S$	h�	-
ymS
�
L��^!aB5��	}	�����N�)
:0
�0��:Z!
f�	��J
�)
�
�	P	�Q��@�
�
�viX	��,	�`��
b
\R	M�!�	|�v
L�	<��
b�
��->
�	�
������&%I9��Sb)�a;�/�j���[�o
K	�&/�G	7`��
w��
������
��J3M��
W'
�
��������:<�����
c���

��	=a�
�	�y
X$
�� �	l	
)	>Q*�
�=�o���b��-Io������}��i�	
��G�\1^kh5
*�m
#	BV�	>B�p�^
�u|��gm�~_|�R�#9�������+�G9$�q�n5��:>��V�(��V��E�(
�
��"�M����
z�2
����a�|
�P
����H�
'7H���Q	��8?
u;�	��������	�
�/)��U�
P��	��3'|�
;
O
!;	����
u
$
e|=H��	��
�8�	����
,�
���&�	C�:���-���	D
�d�
$�
���7
.@�tE6.
%�
��	� j��
l��Ot
�
��&/��F
�3���J���/$4	��
w�>��,

zo�
��3���	�B	:;��A	�bAZ��
$��	fJ��	�
��vw�����1f
�I
��
�
_\
��
n
%d
#�����	����N	�a���{d��gl
�
�.��7���H	?i�;�w�|�����
E�
�s1��w,
�k/�:��d0w�DH����	�T	�t
>X�t0�
���@�
?�.=���
F� ����N
��]�
4��(�?	�mM
L
en
�|�t��6�	y
,}2D			
[<
5�0�z�	
��
"
�
$���Q�	�"��O�o	hJ	5+\H
T/+}*�
~c'��
���r�m��
L����	~)�z����~�k����4yfG��������Q
�Hz�
9
46-
����
r
��E9@���q����yh�	��
� n?^�
`��s�k0��x��
��a-_#��O
�h��	�k9���
��	p�
�R�
���^	�	
=�
�
k
E�n
p�3
��	ZE
.I[��?���f�)
d�i�3��	?�S���R:CH�O �
]g�U��2'�W��D�	����	������
d�K�`*
	��
��'�$_�w
m�����
�_����	��y�
u
H�*���3�
&z��A�

a���cJ?
0��
AAI�
	�	�9
�
�dAH
��M6�
�t'
6�C�y�
�p��
Wk�t
��Lx
*��
4����M�1`	�3&��@	Q��
�
+��(�
`���J�	j)nf� �
�N���J�D�j��Q��U�
��
�S��Of����CoT��u�Y��cK�l{~�8�,��+���`#3-�Fp_2�<6g�����T��	��
a
4
��2
�*3�L-�!�e�~	&�7
��	����
�ONg
�z%[�+	�	V�
q��Y��T�����Y���
��
�m
���N3�C��	C�	�E
�1�
.^�
Z.c��
�TGO
�p�&�u��L������Q���'�:
���
�
��
q�w�_-U	!]	��j	���1�
>	�
gY	xK?�>����	�
f	$Q�?��b������Y�}~��	cg�rd�
�Ys�K
q�U@���q��	���-��~�u�;p
K�tz
�0x��V�aE�UK4�7�J�
�tDs8
{�(�,,G�O��&��x	s���I�
�hpu
k���S���Pa�������O	�v;	�-�
�Z��
��
��k	D����8�*��Z
	H��	�j�����1����
��	�D�g���
(R
t	
7{�J��	tb�7��o���
%(1��r��
������)
��y[
��c��	\����;�U:	������
n�~�	I+D��X�
�������2�
�-T%��q(�
C�8	�W�Gn#
�
�j��T
�������
K�~P�������d��
*�
�����	:����
"=�v��
��
$_���
�Y��6N	�
S
�
5����	P�l�	�
��R���2_	��
$I��U�H>�l��wH�
C	�
�)��	[���I	M�
:	�� x��b6	�e.�z{
�	W��T�
���f
�p�+��ja��!,pF�J1�_�	
.�
�~wu��5^��	���i�'�#h
�	>��o
=�
[\]d8`%o�R���

��	W	wg�Q���e���z	������	��G{	��q}
@�.���
r
"Up1
/$-�F)��	�����e
��f
SC
R��
*��n�	k�9(\
P
�
��	L�
�%�	"�9�0	��
�M�%U
���
@�#��VR�W@	�e�_8�;�Z���<	m5����
�B�V)	�
�

	��`=�o
]
���n�R��
�
Y�	�	$��P�2C�u��
^
����&��	�A
B7�������2��x}
GK�9�P�{������%}�	q�L��FE	^�G�{v[n#e��	����'a���4��V
���A���{�|P��Jx�������5�;
���	@�
�r��
"��	�c
�T��m	yol���<��R(
��l�d	�
e(Y�
'4
]}^�	��	�%&	z4;�8�b��q�
�	�
@�
�/	;��]���h�
��2k�
XsKZ�
�
h[�f���Pi4�3	��T�Z��
�	ruc�
�����
nW
X	��
�����	��$��	��.=
��	y�
�����Dr���
����
��&���
�
����IT�i�T�^�}����S�~
���9�
���	�����=	<v�	P��
e
���,	U�;��
�
�	��n���
�
7s�=�t�	�
K��c������������
�N
]�\{
R�+
�B
9
0k�Y�
#�d
R���f/��l
�/S������
��
�R
 =R�_r��~
*�������h9�}�9y�
��
���
t�)J�^�_��W�
v�e���y	N���<<J���S^�	og	���_
�	��
��
4��G��	jG!	A���
N��
6��C��&
�������
��	�Nr�	��	�"���Q
r	����[�����"�:��1	y'��V��	�	�s��
I
�>
o��
�����i
����6�	*��W
��QA
�
g���
f!9�O#
62)�E��L$�$X�*]2��30o�Y�}����0m
l|N�1�IG�
�f7
+x.���~��	?����
TF	zM�B?
@M�����J�Q.?hO�������Y3��UP��lh������	Cr 	�
� ���
���!���.	�	
�lW�]�
�v&
4�(
�VFU�`
��
X]�f,�
7	�	=S"	��A�	�8�
Z����4�	����i	�
a	��KKam��

X��
F�#���
��k
i
v
�����	D��8v	��p
Is��
�Z	��-
�s
�e�Y���
�L
,J�5	�	��
�
�0�
�	0'���]��	M
%��O
<
�[�4@

0�i1�
/\��
�c	�2�R<����i�@6

|"}m�Z
�
��%qH������>*
��	�7�z"!�	]mw	��"	i
��
�lEt��V���9	�D��	�������"8��
��F�	t���%�
�
��'�6S.
G
@	K+��v:�Z��QuV��	��-C��	]vc
�c��
�F�
WT�6�lI8�Q�
)�2����c�uN���	�[
�
"�+
�g
������`s	8
�k�,�	]�/�9W
O�UX��c
�-F
�
�
�,s�B��
� �
 
\F��b
"
~h���5{��
�3�

��L	v+���95�
��NOX��5�N)���������
�
B����
�Z
����%
�y�H{Le	�V
P!yx�#������*p:
�
2�
����1�v�xD�
\��oo��	D�rEB�	5kW�q{�k�	�����^���	�)�
�l�	�s
I'|	>Y��	��e���n	��)� ����
P8�
�d��Ls�[��/�Hp	 p^�����	;��%�A=
/
9�\���gP��_�	��wM
I��X
h	X��Fs0�	{
aX�a
��+b	j������^��!
! 
x�
��{%�(��	����	�	
�Z�
=��1
�������Wx!g([�
�}+�J
(
&gL�`�dR��
��	���	��y�	���4M��5�	�h�Q�
4	=T
�	�jE�q
_
3
��#t�	y�
�
i{���'
u	�	 
��4�7�:M���
��
��
��Y�;�
��}�l"���
�� ����	t�
�	�[S	������b�B@8*�
nx�q
�M
"b�� <�
�"�Y�
�l���|:v,
G
����f\����
�2��BU
6�k	m��@M`(�@

&��7�d(����>��
�i,���G�
�rD7$|�?3��1F��
Y
6���W���8^5�
��r�w�	�_��o�M/
�b
�
SqA}�
�����V���W��x
Y
6
�-nS2O����
�N�	�
W��5
3E�
�
0
H
���>#{�U>�B�U��
��
	������Gm���
�f
�	:D�
�*h��	?��
�
��[a6kb-	��ZX���
�w�\x
|~]��t�	z�j
�
<�qj+�w��V�.
��RM	!�
�b�z
��	��L�	z�
�b�+�
�

	�	E
�7�X���6�A�
�	V	�
�����,/�J���
�?c�B�!`	j
�`
?�
�
�����yc�	�����e7�jp+e�n�<��	�
�\oVB��r��d�+ihq	��gr
0ZU�>
\���
/1��	�j��
fC��]
uQ�
���C
��C�����^�	;��|
��s�E�
5�
nA�B
Q�&��\	�K,N4�C
B#��
�
&S�	�
�X
���I'X5xSc��b�|)�0���	F���
2�%	 mailer is not supported."%1$s" in %2$s %3$s is not a hex or rgb string."%1$s" is not a supported wp_template_part area value and has been added as "%2$s"."%1$s" script should not be enqueued together with the new widgets editor (%2$s or %3$s)."%1$s" style should not be enqueued together with the new widgets editor (%2$s or %3$s).#%d (no title)$store must be an instance of WP_Style_Engine_CSS_Rules_Store%1$s %2$d%1$s %2$s %3$s %4$s Feed%1$s %2$s %3$s Category Feed%1$s %2$s %3$s Comments Feed%1$s %2$s %3$s Feed%1$s %2$s %3$s Tag Feed%1$s %2$s Comments Feed%1$s %2$s Feed%1$s %2$s Posts by %3$s Feed%1$s %2$s Search Results for &#8220;%3$s&#8221; Feed%1$s %2$s, %3$s ago (%4$s)%1$s &lsaquo; %2$s &#8212; WordPress%1$s (%2$d)%1$s (%2$s)%1$s (since %2$s; %3$s)%1$s (since %2$s; no alternative available)%1$s (since %2$s; use %3$s instead)%1$s > %2$s%1$s Comment<span class="screen-reader-text"> on %2$s</span>%1$s Comments<span class="screen-reader-text"> on %2$s</span>%1$s and %2$s%1$s at %2$s%1$s by %2$s pixels%1$s comment<span class="screen-reader-text"> on %2$s</span>%1$s comments<span class="screen-reader-text"> on %2$s</span>%1$s could not be created: %2$s%1$s does not match pattern %2$s.%1$s does not match the expected format. Reason: %2$s%1$s is a required property of %2$s.%1$s is deprecated. The callback from %2$s is used instead.%1$s is deprecated. Use %2$s instead.%1$s is not %2$s.%1$s is not a valid %2$l.%1$s is not a valid %2$s. Reason: %3$s%1$s is not a valid property of Object.%1$s is not of type %2$s.%1$s is not one of %2$l.%1$s is not one of %2$s.%1$s is proudly powered by %2$s%1$s is your new site. <a href="%2$s">Log in</a> as &#8220;%3$s&#8221; using your existing password.%1$s matches %2$l, but should match only one.%1$s must be a multiple of %2$s.%1$s must be at least %2$s character long.%1$s must be at least %2$s characters long.%1$s must be at most %2$s character long.%1$s must be at most %2$s characters long.%1$s must be between %2$d (exclusive) and %3$d (exclusive)%1$s must be between %2$d (exclusive) and %3$d (inclusive)%1$s must be between %2$d (inclusive) and %3$d (exclusive)%1$s must be between %2$d (inclusive) and %3$d (inclusive)%1$s must be greater than %2$d%1$s must be greater than or equal to %2$d%1$s must be less than %2$d%1$s must be less than or equal to %2$d%1$s must contain at least %2$s item.%1$s must contain at least %2$s items.%1$s must contain at least %2$s property.%1$s must contain at least %2$s properties.%1$s must contain at most %2$s item.%1$s must contain at most %2$s items.%1$s must contain at most %2$s property.%1$s must contain at most %2$s properties.%1$s on %2$s%1$s only accepts a non-empty path string, received %2$s.%1$s or %2$s%1$s response to %2$s%1$s responses to %2$s%1$s response to &#8220;%2$s&#8221;%1$s responses to &#8220;%2$s&#8221;%1$s value "%2$s" must be a valid URL or file reference.%1$s, %2$s%1$s, and %2$s%1$s-%2$s%1$s: %2$s%d Plugin Update%d Plugin Updates%d Theme Update%d Theme Updates%d WordPress Update%d days%d hours%d minutes%d months%d result found%d results found%d seconds%d selected%d themes found%d years%s (Invalid)%s (Pending)%s <span class="says">says:</span>%s <span class="screen-reader-text">Comment</span>%s <span class="screen-reader-text">Comments</span>%s API Key%s Avatar%s Comment%s Comments%s Comment in moderation%s Comments in moderation%s [Autosave]%s [Current Revision]%s ago%s cannot be empty.%s cannot be updated.%s character%s characters%s comment%s comments%s day%s days%s does not match any of the expected formats.%s exceeds the maximum upload size for the multi-file uploader when used in your browser.%s exceeds the maximum upload size for this site.%s failed while writing image to stream.%s from now%s has duplicate items.%s has taken over and is currently customizing.%s hour%s hours%s is a protected WP option and may not be modified%s is already customizing this changeset. Do you want to take over?%s is already customizing this changeset. Please wait until they are done to try customizing. Your latest changes have been autosaved.%s is already customizing this site. Do you want to take over?%s is already customizing this site. Please wait until they are done to try customizing. Your latest changes have been autosaved.%s is forbidden%s is not a valid IP address.%s is not a valid UUID.%s is required to strip image meta.%s is your new username%s item%s items%s link%s matches more than one of the expected formats.%s minute%s minutes%s month%s months%s must set a database connection for use with escaping.%s parameter must be a valid JSON string.%s response%s responses%s second%s seconds%s submenu%s themes%s update available%s updates available%s values must be non-empty strings.%s week%s weeks%s word%s words%s year%s years%s: %l.%sX-Large%sX-Small&#8220;%1$s&#8221; &#8212; %2$s&#8220;%s&#8221; has failed to upload.&#8592; Cancel audio playlist&#8592; Cancel gallery&#8592; Cancel video playlist&#8592; Go to library&hellip;&laquo; Back&laquo; Older Comments&laquo; Previous&laquo; Previous Page&larr; Go to Categories&larr; Go to Link Categories&larr; Go to Pattern Categories&larr; Go to Tags&lt; Prev&mdash; Select &mdash;(%s author archive, opens in a new tab)(%s website link, opens in a new tab)(Edit)(Home link, opens in a new tab)(Must be at least 4 characters, lowercase letters and numbers only.)(This message was added in version %s.)(Unattached)(Untitled)(WordPress could not establish a secure connection to WordPress.org. Please contact your server administrator.)(more&hellip;)(no author)(no title)(opens in a new tab)*+ %s+ Create New Menu, 1 Comment1 Comment<span class="screen-reader-text"> on %s</span>: %s<a href="%1$s" %2$s>Learn how to describe the purpose of the image%3$s</a>. Leave empty if the image is purely decorative.<a href="%1$s">Please update WordPress</a>, and then <a href="%2$s">learn more about updating PHP</a>.<a href="%s">Learn more about updating PHP</a>.<a href="%s">Manage plugins</a>.<a href="%s">Please update WordPress</a>.<strong>Conflicting values for the constants %1$s and %2$s.</strong> The value of %2$s will be assumed to be your subdomain configuration setting.<strong>Could not find site %1$s.</strong> Searched for table %2$s in database %3$s. Is that right?<strong>Database tables are missing.</strong> This means that your host&#8217;s database server is not running, WordPress was not installed properly, or someone deleted %s. You really should look at your database now.<strong>Error:</strong> %1$s in %2$s can only contain numbers, letters, and underscores.<strong>Error:</strong> Cookies are blocked due to unexpected output. For help, please see <a href="%1$s">this documentation</a> or try the <a href="%2$s">support forums</a>.<strong>Error:</strong> Cookies are blocked or not supported by your browser. You must <a href="%s">enable cookies</a> to use WordPress.<strong>Error:</strong> Could not register you&hellip; please contact the <a href="mailto:%s">site admin</a>!<strong>Error:</strong> Invalid username, email address or incorrect password.<strong>Error:</strong> Please enter a username or email address.<strong>Error:</strong> Please enter a username.<strong>Error:</strong> Please enter a valid email address.<strong>Error:</strong> Please fill the required fields.<strong>Error:</strong> Please type your comment text.<strong>Error:</strong> Please type your email address.<strong>Error:</strong> Site URL you&#8217;ve entered is already taken.<strong>Error:</strong> Sorry, that username is not allowed.<strong>Error:</strong> The comment could not be saved. Please try again later.<strong>Error:</strong> The email address is already used.<strong>Error:</strong> The email address is not correct.<strong>Error:</strong> The email could not be sent. Your site may not be correctly configured to send emails. <a href="%s">Get support for resetting your password</a>.<strong>Error:</strong> The email field is empty.<strong>Error:</strong> The password field is empty.<strong>Error:</strong> The password you entered for the email address %s is incorrect.<strong>Error:</strong> The password you entered for the username %s is incorrect.<strong>Error:</strong> The passwords do not match.<strong>Error:</strong> The themes directory is either empty or does not exist. Please check your installation.<strong>Error:</strong> The username <strong>%s</strong> is not registered on this site. If you are unsure of your username, try your email address instead.<strong>Error:</strong> The username field is empty.<strong>Error:</strong> There is no account with that username or email address.<strong>Error:</strong> There was a problem creating site entry.<strong>Error:</strong> This email address is already registered. <a href="%s">Log in</a> with this address or choose another one.<strong>Error:</strong> This is not a valid feed template.<strong>Error:</strong> This username is already registered. Please choose another one.<strong>Error:</strong> This username is invalid because it uses illegal characters. Please enter a valid username.<strong>Error:</strong> Unknown email address. Check again or try your username.<strong>Error:</strong> Unknown username. Check again or try your email address.<strong>Error:</strong> User registration is currently not allowed.<strong>Error:</strong> WordPress %1$s requires MySQL %2$s or higher<strong>Error:</strong> Your URL is too long.<strong>Error:</strong> Your account has been marked as a spammer.<strong>Error:</strong> Your comment is too long.<strong>Error:</strong> Your email address is too long.<strong>Error:</strong> Your name is too long.<strong>Error:</strong> Your password reset link appears to be invalid. Please request a new link below.<strong>Error:</strong> Your password reset link has expired. Please request a new link below.<strong>You have successfully updated WordPress!</strong> Please log back in to see what&#8217;s new.A UUID provided by the application to uniquely identify it. It is recommended to use an UUID v5 with the URL or DNS namespace.A WordPress CommenterA calendar of your site’s posts.A city in the same timezone as you.A cloud of your most used tags.A date format for all date strings.A day number of the week that the week should start on.A description of the pattern.A description of the theme.A detailed variation description.A duplicate event already exists.A font face matching those settings already exists.A font family with slug "%s" already exists.A human-readable description of the post type.A human-readable description of the taxonomy.A human-readable variation title.A key value mismatch has been detected. Please follow the link provided in your activation email.A label describing the test.A link to a pattern category.A link to a post formatA list of allowed area values for template parts.A list of default template types.A list of the inner block's own inner blocks. This is a recursive definition following the parent innerBlocks schema.A list of your site&#8217;s Pages.A list or dropdown of categories.A media item.A monthly archive of your site&#8217;s Posts.A more descriptive explanation of what the test looks for, and why it is important for the user.A name is required for this term.A named status for the object.A named status for the post.A named status for the theme.A new comment on the post "%s" is waiting for your approvalA new pingback on the post "%s" is waiting for your approvalA new trackback on the post "%s" is waiting for your approvalA password protected post can not be set to sticky.A password to protect access to the content and excerpt.A plugin disallowed this event.A plugin prevented the event from being rescheduled.A plugin prevented the event from being scheduled.A plugin prevented the event from being unscheduled.A plugin prevented the hook from being cleared.A post can not be sticky and have a password.A recovery link was already sent %1$s ago. Please wait another %2$s before requesting a new email.A search form for your site.A set of high quality curated patterns.A short description of the block, in human readable format.A speculation rule must include either a "%1$s" key or a "%2$s" key, but not both.A speculation rule of source "%1$s" must not include a "%2$s" key.A speculation rule with ID "%s" already exists.A static pageA sticky post can not be password protected.A structure tag is required when using custom permalinks. <a href="%s">Learn more</a>A term with the name provided already exists in this taxonomy.A term with the name provided already exists with this parent.A time format for all time strings.A title on that page cannot be found.A valid URL was not provided.A valid email address is required.A variable mismatch has been detected.A variety of designs displaying site navigation.A variety of designs to display your team members.A variety of footer designs displaying information and site navigation.A variety of header designs displaying your site title and navigation.A widget containing a block.AI features are not supported in this environment.AMAPI key for the %s connector.Abilities must be registered on the %1$s action. The ability %2$s was not registered.Abilities that perform destructive actions require DELETE method.Abilities that perform updates require POST method.Abilities that retrieve or modify site information and settings.Abilities that retrieve or modify user information and settings.Ability "%1$s" callback threw an exception: %2$sAbility "%1$s" has invalid input. Reason: %2$sAbility "%1$s" has invalid output. Reason: %2$sAbility "%s" does not define an input schema required to validate the provided input.Ability "%s" does not have a valid execute callback.Ability "%s" does not have a valid permission callback.Ability "%s" does not have necessary permission.Ability "%s" is already registered.Ability "%s" not foundAbility "%s" not found.Ability "%s" was not specified in the allowed abilities list.Ability API should not be initialized before the %s action has fired.Ability categories must be registered on the %1$s action. The ability category %2$s was not registered.Ability category "%1$s" is not registered. Please register the ability category before assigning it to ability "%2$s".Ability category "%s" is already registered.Ability category "%s" not found.Ability category not found.Ability category slug must contain only lowercase alphanumeric characters and dashes.Ability category this ability belongs to.Ability name must be a string containing a namespace prefix, i.e. "my-plugin/my-ability". It can only contain lowercase alphanumeric characters, dashes and the forward slash.Ability not found.About WordPressAccessibilityActionAction has been confirmed.ActionsActivateActivate &amp; PublishActivation Key RequiredActivation Key:Active themeActive theme: %1$s (version %2$s)ActivityAddAdd CategoryAdd ChangesetAdd Header ImageAdd ImageAdd ItemsAdd LinkAdd Link CategoryAdd MediaAdd Media FileAdd Menu ItemsAdd Navigation MenuAdd PageAdd PatternAdd PostAdd TagAdd TemplateAdd Template PartAdd a WidgetAdd a navigation menu to your sidebar.Add alternate sources for maximum HTML5 playbackAdd audio sourceAdd mediaAdd or remove menu itemsAdd or remove pattern categoriesAdd or remove tagsAdd subtitlesAdd titleAdd to Audio PlaylistAdd to DictionaryAdd to MenuAdd to WidgetAdd to audio playlistAdd to galleryAdd to menu: %1$s (%2$s)Add to video PlaylistAdd to video playlistAdd video sourceAdd your own CSS code here to customize the appearance and layout of your site.AddedAdded:Adding an RSS feed to this site’s homepage is not supported, as it could lead to a loop that slows down your site. Try using another block, like the <strong>Latest Posts</strong> block, to list posts from the site.Additional CSSAdditional SMTP info: Additional images added to this gallery: %sAdditional items found: %dAdditional shortcuts,Administration email verificationAdvancedAdvanced OptionsAfrikaansAkismet Anti-spamAlbanianAlbumAlignAlign centerAlign leftAlign rightAlignmentAlignment optionNoneAll CategoriesAll ChangesetsAll Link CategoriesAll PagesAll PatternsAll PostsAll TagsAll capabilities assigned to the user.All capabilities used by the post type.All capabilities used by the taxonomy.All datesAll features, supported by the post type.All media itemsAll required plugins are installed and activated.AllowAllow comments on new postsAllow link notifications from other blogs (pingbacks and trackbacks) on new articles.Allow link notifications from other blogs (pingbacks and trackbacks) on new posts.Allow new users to sign upAllow people to submit comments on new posts.Allow search engines to index this site.Allowed FilesAllowed child block types.Allows use of HTML5 markup for search forms, comment forms, comment lists, gallery, and caption.Already InstalledAlt TextAlternative TextAlternative sourceAlternative text to display when attachment is not displayed.Ambiguous term name used in a hierarchical taxonomy. Please use term ID instead.An alphanumeric identifier for the menu location.An alphanumeric identifier for the post type.An alphanumeric identifier for the post unique to its type.An alphanumeric identifier for the revision unique to its type.An alphanumeric identifier for the status.An alphanumeric identifier for the taxonomy.An alphanumeric identifier for the term unique to its type.An alphanumeric identifier for the user.An application name is required to create an application password.An array of post types that the pattern is restricted to be used with.An array of template types where the pattern fits.An array of the class names for the post container element.An error has occurred, which probably means the feed is down. Try again later.An error has occurred. Please reload the page and try again.An error occurred adding you to this site. Go to the <a href="%s">homepage</a>.An error occurred during the activationAn error occurred in the upload. Please try again later.An error occurred while customizing. Please refresh the page and try again.An error occurred while processing your comment. Please ensure all fields are filled correctly and try again.An error occurred while processing your request. Please try again later.An error occurred.An error occurred. Please try again later.An error of type %1$s was caused in line %2$s of the file %3$s. Error message: %4$sAn image should not be lazy-loaded and marked as high priority at the same time.An incomplete personal data request for this email address already exists.An unexpected error occurred. Something may be wrong with WordPress.org or this server&#8217;s configuration. If you continue to have problems, please try the <a href="%s">support forums</a>.Ancestor blocks.Angle to rotate clockwise in degrees.Annotations for the ability.AnonymousAny extra capabilities assigned to the user.App icon preview: Current image: %sApp icon preview: The current image has no alternative text. The file name is: %sAppearanceApplication password not found.Application passwords are not available for your account. Please contact the site administrator for assistance.Application passwords are not available.ApplyApprove it: %sAprilApril abbreviationAprArabicArbitrary HTML code.Arbitrary text.Archive <span class="count">(%s)</span>Archives <span class="count">(%s)</span>ArchivesAre you sure it exists?Are you sure the database server is not under particularly heavy load?Are you sure the database server is running?Are you sure you have the correct username and password?Are you sure you have typed the correct hostname?Are you sure you want to delete this theme?Are you sure you want to discard your unpublished changes?Are you sure you want to do this?Argument %s is deprecatedArguments cannot be prepared as both an Identifier and Value. Found the following conflicts: %sArray of column names to be searched.Array of image edits.ArtistAs a percentage of the image, the height to crop the image to. DEPRECATED: Use `modifiers` instead.As a percentage of the image, the width to crop the image to. DEPRECATED: Use `modifiers` instead.As a percentage of the image, the x position to start the crop from. DEPRECATED: Use `modifiers` instead.As a percentage of the image, the y position to start the crop from. DEPRECATED: Use `modifiers` instead.As an app icon and a browser icon.AscendingAspect ratio nameClassic - 3:2Aspect ratio nameClassic Portrait - 2:3Aspect ratio namePortrait - 3:4Aspect ratio nameSquare - 1:1Aspect ratio nameStandard - 4:3Aspect ratio nameTall - 9:16Aspect ratio nameWide - 16:9Assign a parent term to create a hierarchy. The term Jazz, for example, would be the parent of Bebop and Big Band.Attachment AttributesAttachment DetailsAttachment Display SettingsAttachment PageAttachment PagesAttachment PreviewAttachment detailsAttachment file size in bytes.Attachment post IDAttachment type.Attempted to set image quality outside of the range [1,100].Attempting to parse a shortcode without a valid callback: %sAttributesAttributes for the block.AudioAudio <span class="count">(%s)</span>Audio <span class="count">(%s)</span>Audio PlayerAudio WidgetAudio Widget (%d)Audio Widget (%d)Audio detailsAudio titleAudio title&hellip;AugustAugust abbreviationAugAuthorAuthor URL of the user.Author:Author: %1$s (IP address: %2$s, %3$s)Author: %sAutomatically add new top-level pages to this menuAutomatically add paragraphsAutoplayAvatar URL with image size of %d pixels.Avatar URLs for the comment author.Avatar URLs for the user.BackBackground ColorBackground ImageBackground PresetPresetBackground colorBase64 encoded representation of the instance settings.BelarusianBinding event handler attributes is not supported. Please use "%s" instead.BitrateBitrate ModeBitrate:BlackBlavatarBlockBlock "%1$s" does not contain a style named "%2$s".Block "%1$s" is declaring %2$s support in %3$s file under %4$s. %2$s support is now declared under %5$s.Block HTML:Block attributes.Block binding "%s" not found.Block bindings source "%s" already registered.Block bindings source name must be a string.Block bindings source names must contain a namespace prefix. Example: my-plugin/my-custom-sourceBlock bindings source names must not contain uppercase characters.Block category.Block example.Block keywords.Block metadata collections cannot be registered as one of the following directories or their parent directories: %sBlock name must be a string or array.Block name.Block namespace.Block pattern categoryAboutBlock pattern categoryAudioBlock pattern categoryBannersBlock pattern categoryButtonsBlock pattern categoryCall to actionBlock pattern categoryColumnsBlock pattern categoryContactBlock pattern categoryFeaturedBlock pattern categoryFootersBlock pattern categoryGalleryBlock pattern categoryHeadersBlock pattern categoryMediaBlock pattern categoryNavigationBlock pattern categoryPortfolioBlock pattern categoryPostsBlock pattern categoryServicesBlock pattern categoryTeamBlock pattern categoryTestimonialsBlock pattern categoryTextBlock pattern categoryVideosBlock pattern category "%s" not found.Block pattern category name must be a string.Block pattern titleGridBlock pattern titleImage at leftBlock pattern titleLarge titleBlock pattern titleNavigation OverlayBlock pattern titleOffsetBlock pattern titleOverlay with black backgroundBlock pattern titleOverlay with centered navigationBlock pattern titleOverlay with orange backgroundBlock pattern titleOverlay with site info and CTABlock pattern titleSmall image and titleBlock pattern titleSocial links with a shared background colorBlock pattern titleStandardBlock style name must be a string.Block style name must not contain any spaces.Block style variations.Block supports.Block type "%s" is already registered.Block type "%s" is not registered.Block type names must be strings.Block type names must contain a namespace prefix. Example: my-plugin/my-custom-block-typeBlock type names must not contain uppercase characters.Block types that the pattern is intended to be used with.Block variations.BlockquoteBlog pages show at most.BlueBoldBold sections designed to showcase key content.BookmarksBorderBorder colorBoth registration and last updated dates must be provided.Both registration and last updated dates must be valid dates.BottomBottom LeftBottom RightBreadcrumbsBriefly describe what your business does and how you can help.Briefly unavailable for scheduled maintenance. Check back in a minute.BrownBrowser icon preview: Current image: %sBrowser icon preview: The current image has no alternative text. The file name is: %sBulgarianBulk selectBulleted listBut, before you can start using your new username, <strong>you must activate it</strong>.But, before you can start using your site, <strong>you must activate it</strong>.By %sBy: %sCSS ClassesCSS ascent-override value.CSS codeCSS descent-override value.CSS font-display value.CSS font-family value.CSS font-feature-settings value.CSS font-stretch value.CSS font-style value.CSS font-variant value.CSS font-variation-settings value.CSS line-gap-override value.CSS size-adjust value.CSS unicode-range value.Cache key must be an integer or a non-empty string, %s given.Cache key must not be an empty string.CalendarCall %s to create an HTML Processor instead of calling the constructor directly.CancelCancel editCancel replyCannot create a comment with that type.Cannot create a revision of a revisionCannot create a user with an empty login name.Cannot create a user with an empty nicename.Cannot create existing comment.Cannot create existing post.Cannot create existing user.Cannot delete an active plugin. Please deactivate it first.Cannot find user global styles revisions.Cannot hook block to itself.Cannot introspect application password.Cannot preview a widget that does not extend WP_Widget.Cannot resize the image. Both width and height are not set.Cannot select databaseCannot set bookmarks on tokens that do no appear in the original HTML text.Cannot set instance on a widget that does not extend WP_Widget.Cannot set or reset variable: Cannot set parent term, taxonomy is not hierarchical.Cannot stabilize objects. Convert the object to an array first.Cannot supply a fetchpriority `%1$s` for script `%2$s` because it is an alias (it lacks a `src` value).Cannot supply a strategy `%1$s` for script `%2$s` because it is an alias (it lacks a `src` value).Cannot view post type.Cannot view status.CaptionCaption for the attachment, as it exists in the database.Caption&hellip;Captions/SubtitlesCatalanCategoriesCategories dropdown (show_option_none parameter)NoneCategories listCategories list navigationCell paddingCell spacingCell typeCenterChangeChange FrequencyChange audioChange fileChange imageChange logoChange themeChange videoChanges have already been trashed.Changes trashed successfully.Changeset is being edited by other user.ChaptersCheck SpellingCheck the junk or spam folder of your email client. Sometime emails wind up there by mistake.Check your emailCheck your email for the confirmation link, then visit the <a href="%s">login page</a>.Check your inbox at %s and click on the given link.ChineseChinese (Simplified)Chinese (Traditional)Choose audioChoose fileChoose from the most used pattern categoriesChoose from the most used tagsChoose imageChoose logoChoose videoCityClass %1$s is <strong>deprecated</strong> since version %2$s with no alternative available.Class %1$s is <strong>deprecated</strong> since version %2$s! Use %3$s instead.Class nameClass names for the link element of this menu item.Classic Block Keyboard ShortcutsClearClear ResultsClear formattingClick &#8220;Add Image&#8221; to upload an image file from your computer. Your theme works best with an image that matches the size of your video &#8212; you&#8217;ll be able to crop your image once you upload it for a perfect fit.Click &#8220;Add Image&#8221; to upload an image file from your computer. Your theme works best with an image with a header height of %s pixels &#8212; you&#8217;ll be able to crop your image once you upload it for a perfect fit.Click &#8220;Add Image&#8221; to upload an image file from your computer. Your theme works best with an image with a header size of %s pixels &#8212; you&#8217;ll be able to crop your image once you upload it for a perfect fit.Click &#8220;Add Image&#8221; to upload an image file from your computer. Your theme works best with an image with a header width of %s pixels &#8212; you&#8217;ll be able to crop your image once you upload it for a perfect fit.Click &#8220;Next&#8221; to start adding links to your new menu.Click here to cancel reply.Click to edit the site title.Click to edit this element.Click to edit this menu.Click to edit this widget.CloseClose all open tagsClose blockquote tagClose bold tagClose bulleted list tagClose code tagClose deleted text tagClose dialogClose inserted text tagClose italic tagClose list item tagClose menuClose numbered list tagClose reorder modeClose sharing dialogClose uploaderCmd + letter:CodeCollapseColorColor nameBlackColor nameCyan bluish grayColor nameLight green cyanColor nameLuminous vivid amberColor nameLuminous vivid orangeColor namePale cyan blueColor namePale pinkColor nameVivid cyan blueColor nameVivid green cyanColor nameVivid purpleColor nameVivid redColor nameWhiteColorsColumnColumn groupColumnsComma-separated list of replacement words in your language&#8217;tain&#8217;t,&#8217;twere,&#8217;twas,&#8217;tis,&#8217;twill,&#8217;til,&#8217;bout,&#8217;nuff,&#8217;round,&#8217;cause,&#8217;emComma-separated list of search stopwords in your languageabout,an,are,as,at,be,by,com,for,from,how,in,is,it,of,on,or,that,the,this,to,was,what,when,where,who,will,with,wwwComma-separated list of words to texturize in your language'tain't,'twere,'twas,'tis,'twill,'til,'bout,'nuff,'round,'cause,'emCommentComment %d contains personal data but could not be anonymized.Comment AuthorComment Author EmailComment Author IPComment Author URLComment Author User AgentComment ContentComment DateComment Submission FailureComment URLComment author name and email are required.Comment field exceeds maximum length allowed.Comment is required.Comment number declension: on or offoffComment on %1$s by %2$sComment statusComment: %sCommentsComments FeedComments Off<span class="screen-reader-text"> on %s</span>Comments Page %sComments are closed.Comments feedComments for %1$s searching on %2$sComments for %sComments navigationComments on %sComments on: %sComments paginationCommunity Events LocationCompleted <span class="count">(%s)</span>Completed <span class="count">(%s)</span>Conditional query tags do not work before the query is run. Before then, they always return false.Confirm new passwordConfirm the "%s" actionConfirm use of weak passwordConfirm your administration emailConfirmed <span class="count">(%s)</span>Confirmed <span class="count">(%s)</span>Congratulations! Your new site, %s, is almost ready.Connector "%s" authentication constant_name must be a non-empty string.Connector "%s" authentication env_var_name must be a non-empty string.Connector "%s" authentication method must be "api_key" or "none".Connector "%s" authentication setting_name must be a non-empty string.Connector "%s" is already registered.Connector "%s" not found.Connector "%s" plugin is_active must be callable.Connector "%s" requires a non-empty "name" string.Connector "%s" requires a non-empty "type" string.Connector "%s" requires an "authentication" array.Connector ID must contain only lowercase alphanumeric characters, hyphens, and underscores.ConnectorsConstrain proportionsContains the handle that defines the block style.ContentContent for the comment, as it exists in the database.Content for the post, as it exists in the database.Content for the template, as it exists in the database.Content hash did not match expected.Content of template.Content, title, and excerpt are empty.Content:Context provided by blocks of this type.Context values inherited by blocks of this type.ContinueContinue reading %sConvert emoticons like :-) and :-P to graphics on display.Cookie check failedCookie expired.CopiedCopied!CopyCopy URLCopy URL to clipboardCopy and paste this URL into your WordPress site to embedCopy and paste this code into your site to embedCopy table rowCore icon collection manifest is empty or invalid.Core icon collection manifest is missing or unreadable.Core icon collection manifest must provide valid a "filePath" for each icon.Could not access file: Could not access filesystem.Could not calculate resized image dimensionsCould not create userCould not delete application password.Could not delete application passwords.Could not delete meta value from database.Could not delete site from the database.Could not execute: Could not find an application password with that id.Could not find the specified string.Could not generate XML sitemap due to missing %s extensionCould not insert attachment into the database.Could not insert post into the database.Could not insert site into the database.Could not insert term into the database.Could not insert term relationship into the database.Could not insert term taxonomy into the database.Could not instantiate mail function.Could not open file handle.Could not open handle for %1$s to %2$s.Could not parse the path.Could not read image size.Could not register file "%1$s" as a block pattern (invalid slug "%2$s")Could not register file "%s" as a block pattern ("Slug" field missing)Could not register file "%s" as a block pattern ("Title" field missing)Could not register file "%s" as a block pattern as the file does not exist.Could not retrieve site data.Could not retrieve table charset.Could not sanitize the %1$s option. Error code: %2$sCould not save application password.Could not split shared term.Could not strip invalid text.Could not update attachment in the database.Could not update comment in the database.Could not update comment status.Could not update post in the database.Could not update site in the database.Could not update the email last sent time.Could not update the meta value of %s in database.Could not write file %1$s (%2$s).Could not write file %sCountryCreateCreate MenuCreate New MenuCreate SiteCreate a Configuration FileCreate a menu for this locationCreate a new galleryCreate a new playlistCreate a new video playlistCreate a site or only a username:Create audio playlistCreate galleryCreate video playlistCreating a comment requires valid author name and email values.Creating comment failed.CroatianCron reschedule event error for hook: %1$s, Error code: %2$s, Error message: %3$s, Data: %4$sCron unschedule event error for hook: %1$s, Error code: %2$s, Error message: %3$s, Data: %4$sCropCrop arguments.Crop imageCrop thumbnail to exact dimensionsCrop type.Crop your imageCropping&hellip;Crunching&hellip;Cryptographic hash of the instance settings.Ctrl + Alt + letter:Ctrl + letter:Current administration email: %sCurrent headerCurrent instance settings of the widget.Current page of the collection.Current plugin: %1$s (version %2$s)Currently %s comment is waiting for approval. Please visit the moderation panel:Currently %s comments are waiting for approval. Please visit the moderation panel:Custom CSSCustom CSS selectors.Custom ColorsCustom HTMLCustom HTML WidgetCustom LinkCustom LinksCustom PresetCustomCustom SizeCustom URLCustom background if defined by the theme.Custom colorCustom color palette if defined by the theme.Custom font sizes if defined by the theme.Custom gradient presets if defined by the theme.Custom header if defined by the theme.Custom logo if defined by the theme.Custom spacing sizes if defined by the theme.CustomizeCustomize theme: %sCustomize: %sCustomizerCustomizingCustomizing &#9656; %sCutCut table rowCzechDanishDashboardDatabase ErrorDateDate FormatDate/timeDayDeactivateDecemberDecember abbreviationDecDecrease indentDefaultDefault AvatarDefault PresetDefaultDefault post category.Default post format.Default shortcuts,Default templateDeleteDelete MenuDelete columnDelete it: %sDelete permanentlyDelete rowDelete tableDeleted author: %sDeleted text (strikethrough)Deleted:DescendingDescriptionDescription for the attachment, as it exists in the database.Description of block type.Description of sidebar.Description of template.Description of the ability.Description of the category.Description of the user.Description of the widget.DeselectDestination directory for file streaming does not exist or is not writable.DetachDetail: DetailsDetails about the media file, specific to its type.Details for theme: %sDetermines whether the pattern is visible in inserter.Did you just paste HTML?Did you know there is a &#8220;Custom HTML&#8221; widget now? You can find it by pressing the &#8220;<a class="add-widget" href="#">Add a Widget</a>&#8221; button and searching for &#8220;HTML&#8221;. Check it out to add some custom code to your site!Did you know there is a &#8220;Custom HTML&#8221; widget now? You can find it by scanning the list of available widgets on this screen. Check it out to add some custom code to your site!Different layouts containing audio.Different layouts containing video or audio.Different layouts containing videos.Different layouts for displaying images.DimensionsDimensions:Directory sizes could not be returned.DisableDiscard changesDiscussionDismissDismiss errorsDisplay SettingsDisplay Site Title and TaglineDisplay a list of assigned terms from the taxonomy: %sDisplay as dropdownDisplay item author if available?Display item content?Display item date?Display label for the ability.Display label for the category.Display name based on first name and last name%1$s %2$sDisplay name for the comment author.Display name for the user.Display post date?Display your contact information.Display your latest posts in lists, grids or other layouts.Displaying %1$s of %2$sDisplaying %1$s – %2$s of %3$sDisplaying %d themesDisplays a custom taxonomy archive. Like categories and tags, taxonomies have terms which you use to classify things. For example: a taxonomy named "Art" can have multiple terms, such as "Modern" and "18th Century." This template will serve as a fallback when a more specific template (e.g. Taxonomy: Art) cannot be found.Displays a post archive when a specific date is visited (e.g., example.com/2023/).Displays a post category archive. This template will serve as a fallback when a more specific template (e.g. Category: Recipes) cannot be found.Displays a post tag archive. This template will serve as a fallback when a more specific template (e.g. Tag: Pizza) cannot be found.Displays a single author's post archive. This template will serve as a fallback when a more specific template (e.g. Author: Admin) cannot be found.Displays a single post on your website unless a custom template has been applied to that post or a dedicated template exists.Displays a static page unless a custom template has been applied to that page or a dedicated template exists.Displays a video from the media library or from YouTube, Vimeo, or another provider.Displays an audio player.Displays an image gallery.Displays an image.Displays any archive, including posts by a single author, category, tag, taxonomy, custom post type, and date. This template will serve as a fallback when more specific templates (e.g. Category or Tag) cannot be found.Displays any single entry, such as a post or a page. This template will serve as a fallback when a more specific template (e.g. Single Post, Page, or Attachment) cannot be found.Displays the %s post format archive.Displays the latest posts as either the site homepage or as the "Posts page" as defined under reading settings. If it exists, the Front Page template overrides this template when posts are shown on the homepage.Displays when a visitor performs a search on your website.Displays when a visitor views a non-existent page, such as a dead link or a mistyped URL.Displays when a visitor views the dedicated page that exists for any media attachment.Displays your site's Privacy Policy page.Displays your site's homepage, whether it is set to display latest posts or a static page. The Front Page template takes precedence over all templates.Distraction-free writing modeDo not deregister the %1$s script in the administration area. To target the front-end theme, use the %2$s hook.Do not pass %1$s tags to %2$s.Do you really want to <a href="%s">log out</a>?Document <span class="count">(%s)</span>Documents <span class="count">(%s)</span>Document PreviewDocument propertiesDocumentationDocumentsDoes the user %1$s have permission to use the %2$s database?DoneDownload FileDownload fileDownloading your new theme&hellip;DraftDraft <span class="count">(%s)</span>Drafts <span class="count">(%s)</span>Draft SavedDrag and drop to reorder media files.Drag and drop to reorder tracks.Drag and drop to reorder videos.Drop files to uploadDuotone nameBlue and orangeDuotone nameBlue and redDuotone nameDark grayscaleDuotone nameGrayscaleDuotone nameMagenta and yellowDuotone nameMidnightDuotone namePurple and greenDuotone namePurple and yellowDuplicate comment detected; it looks as though you&#8217;ve already said that!DutchEXIF orientation value. Values 1-8 follow the EXIF specification, where 1 means no rotation needed.Each font src must be a non-empty string.Each webfont src must be a non-empty string.EditEdit %1$s (%2$s, %3$d of %4$d)Edit %1$s (%2$s, sub-item %3$d of %4$d under %5$s)Edit %1$s (%2$s, sub-item %3$d of %4$d under %5$s, level %6$d)Edit %1$s (%2$s, sub-item %3$d of %4$d under %5$s, level %6$s)Edit Block PatternEdit CategoryEdit ChangesetEdit ImageEdit Link CategoryEdit MediaEdit MenuEdit Navigation MenuEdit OriginalEdit PageEdit Pattern CategoryEdit PostEdit ProfileEdit SelectionEdit SiteEdit TagEdit TemplateEdit Template PartEdit ThisEdit UserEdit audio playlistEdit galleryEdit imageEdit more detailsEdit next media itemEdit previous media itemEdit selected menuEdit templateEdit video playlistEditor menu (when enabled)Editor script handle. DEPRECATED: Use `editor_script_handles` instead.Editor script handles.Editor style handle. DEPRECATED: Use `editor_style_handles` instead.Editor style handles.Editor toolbarElements pathEmailEmail address for the comment author.Email checks are rate limited to once every %s.Email&nbsp;Address:Email: %sEmbedEmbed HandlerEmbed Media PlayerEmbed of %s.Embed or LinkEmbedsEmoticonsEmpty Term.Empty filenameEmpty title.EnableEncodingEnglishEnlargeEnlarge %1$s of %2$sEnlarged imageEnlarged image %1$s of %2$sEnlarged image %1$s of %2$s: %3$sEnlarged image: %sEnlarged imagesEnsure result set excludes comments assigned to specific user IDs. Requires authorization.Ensure result set excludes posts assigned to specific authors.Ensure result set excludes specific IDs.Ensure result set excludes specific parent IDs.Enter a description of the imageEnter desktop preview modeEnter mobile preview modeEnter tablet preview modeEnter the RSS feed URL here:Enter the URLEnter the URL of the imageEnter the destination URLEnter your new password below or generate one.Enter your password to view comments.Entries feedEntries from any RSS or Atom feed.Entries in dependencies array must be either strings or arrays with an id key.Erase Personal DataError DetailsError creating new user.Error decoding the font collection JSON file contents.Error decoding the font collection data from the HTTP response JSON.Error establishing a database connectionError fetching feed %1$s: %2$sError fetching the font collection data from "%s".Error in deleting the attachment.Error not caused by a plugin or theme.Error occurred on a non-protected endpoint.Error reconnecting to the databaseError when decoding a JSON file at path %1$s: %2$sEstonianEvent schedule does not exist.Event timestamp must be a valid Unix timestamp.ExcerptExcerpt for the post, as it exists in the database.Exclude:Exit Recovery ModeExit recovery mode link expired.Expand search fieldExpected string to start with script tag (without attributes) and end with script tag, with optional whitespace.ExpirationExport Personal DataExport as JSONExtension missing: Extra CSS class to assign to the sidebar in the Widgets interface.F j, YF j, Y g:i aF, YFailed <span class="count">(%s)</span>Failed <span class="count">(%s)</span>Failed to delete the page.Failed to exit recovery mode. Please try again later.Failed to store the error.Failed to write request to temporary file.Features supported by this theme.FebruaryFebruary abbreviationFebFeed for all posts filed under %sFeedbackFields other than %s are not currently supported for sitemaps.Fields other than %s are not currently supported for the sitemap index.File %1$s is <strong>deprecated</strong> since version %2$s with no alternative available.File %1$s is <strong>deprecated</strong> since version %2$s! Use %3$s instead.File %1$s must be used in %2$s.File %s doesn't exist!File &#8220;%s&#8221; does not exist?File &#8220;%s&#8221; is not an image.File Error: Could not open file: File URL:File canceled.File does not exist?File is not an image.File name:File size:File type:FilipinoFill ScreenFilter %s returned items with reserved names.Filter Navigation Menu listFilter by categoryFilter by dateFilter by typeFilter mediaFilter pages listFilter patterns listFilter posts listFilter template parts listFilter templates listFilter themesFilter themes (%s)Find and replaceFind out how we can help your business.FinnishFirst PostFirst name for the user.First pageFit to ScreenFixed LayoutFlipFlip arguments.Flip direction.Flip type.Fluid LayoutFocus shortcuts:Font FaceFont FacesFont FamiliesFont FamilyFont SizesFont collection "%1$s" has missing or empty property: "%2$s".Font collection "%s" not found.Font collection JSON file is invalid or does not exist.Font collection not found.Font collection slug "%s" is not valid. Slugs must use only alphanumeric characters, dashes, and underscores.Font collection with slug: "%s" is already registered.Font faces do not support trashing. Set "%s" to delete.Font font-family must be a non-empty string.Font font-weight must be a properly formatted string or integer.Font size nameExtra LargeFont size nameLargeFont size nameMediumFont size nameSmallFont src must be a non-empty string or an array of strings.FontsFootnotesFrenchFriFridayFriday initialFFull SizeFullscreenFunction %1$s is <strong>deprecated</strong> since version %2$s with no alternative available.Function %1$s is <strong>deprecated</strong> since version %2$s! Use %3$s instead.Function %1$s was called <strong>incorrectly</strong>. %2$s %3$sFunction %1$s was called with an argument that is <strong>deprecated</strong> since version %2$s with no alternative available.Function %1$s was called with an argument that is <strong>deprecated</strong> since version %2$s! %3$sFunction %s used incorrectly in PHP.GUID for the post, as it exists in the database.GUID for the post, transformed for display.GUID for the revision, as it exists in the database.GalicianGalleryGallery SettingsGeneralGeneral templates often perform a specific role like displaying post content, and are not tied to any particular area.Generate PasswordGenreGermanGet <em>another</em> %s site in secondsGet Environment InfoGet InvolvedGet New PasswordGet Site InformationGet User InformationGet linked object.Get started today!Get your own %s account in secondsGimme a site!Give the feed a title (optional):Global settings.Global styles to include in themes.Global styles.Go backGo to theme sourcesGoogle Font Name and VariantsNoto Serif:400,400i,700,700iGradient nameBlush bordeauxGradient nameBlush light purpleGradient nameCool to warm spectrumGradient nameElectric grassGradient nameLight green cyan to vivid green cyanGradient nameLuminous duskGradient nameLuminous vivid amber to luminous vivid orangeGradient nameLuminous vivid orange to vivid redGradient nameMidnightGradient namePale oceanGradient nameVery light gray to cyan bluish grayGradient nameVivid cyan blue to vivid purpleGrayGreekGreenGreetings Network Administrator!Grid viewHTMLHTML EmbedHTML caption for the attachment, transformed for display.HTML containing an action to direct the user to where they can resolve the issue.HTML content for the comment, transformed for display.HTML content for the post, transformed for display.HTML content to append to each widget's HTML output when assigned to this sidebar. Default is a closing list item element.HTML content to append to the sidebar title when displayed. Default is a closing h2 element.HTML content to prepend to each widget's HTML output when assigned to this sidebar. Default is an opening list item element.HTML content to prepend to the sidebar title when displayed. Default is an opening h2 element.HTML description for the attachment, transformed for display.HTML description of the term.HTML elementsInlineHTML excerpt for the post, transformed for display.HTML for the theme author, transformed for display.HTML representation of the widget admin form.HTML representation of the widget.HTML tagAddressHTML tagDivHTML tagPreHTML tagPreformattedHTML title for the object, transformed for display.HTML title for the post, transformed for display.HTML title for the template, transformed for display.HTML title for the term.HTTP redirect status code must be a redirection code, 3xx.HTTPS request failed.Haitian CreoleHave you entered your email correctly? You have entered %s, if it&#8217;s incorrect, you will not receive your email.Header ImageHeader MediaHeader Text ColorHeader VideoHeader cellHeading 1Heading 2Heading 3Heading 4Heading 5Heading 6HebrewHeightHeight of the crop as a percentage of the image height.HelpHey there, looks like you just pasted HTML into the &#8220;Visual&#8221; tab of the Text widget. You may want to paste your code into the &#8220;Code&#8221; tab instead. Alternately, try out the new &#8220;Custom HTML&#8221; widget!Hi ###USERNAME###,

This notice confirms that your email address on ###SITENAME### was changed to ###NEW_EMAIL###.

If you did not change your email, please contact the Site Administrator at
###ADMIN_EMAIL###

This email has been sent to ###EMAIL###

Regards,
All at ###SITENAME###
###SITEURL###Hi ###USERNAME###,

This notice confirms that your password was changed on ###SITENAME###.

If you did not change your password, please contact the Site Administrator at
###ADMIN_EMAIL###

This email has been sent to ###EMAIL###

Regards,
All at ###SITENAME###
###SITEURL###Hi,

This notice confirms that the admin email address was changed on ###SITENAME###.

The new admin email address is ###NEW_EMAIL###.

This email has been sent to ###OLD_EMAIL###

Regards,
All at ###SITENAME###
###SITEURL###Hi,

This notice confirms that the network admin email address was changed on ###SITENAME###.

The new network admin email address is ###NEW_EMAIL###.

This email has been sent to ###OLD_EMAIL###

Regards,
All at ###SITENAME###
###SITEURL###HideHide header imageHide imageHide passwordHindiHint: The password should be at least twelve characters long. To make it stronger, use upper and lower case letters, numbers, and symbols like ! " ? $ % ^ &amp; ).HomeHomepageHomepage SettingsHomepage and posts page must be different.Hook %1$s is <strong>deprecated</strong> since version %2$s with no alternative available.Hook %1$s is <strong>deprecated</strong> since version %2$s! Use %3$s instead.Horizontal lineHorizontal position from the left to begin the crop as a percentage of the image width.Horizontal spaceHourHow many items would you like to display?How to interpret the search input.Howdy ###USERNAME###,

You recently requested to have the email address on your account changed.

If this is correct, please click on the following link to change it:
###ADMIN_URL###

You can safely ignore and delete this email if you do not want to
take this action.

This email has been sent to ###EMAIL###

Regards,
All at ###SITENAME###
###SITEURL###Howdy ###USERNAME###,

You recently requested to have the network admin email address on
your network changed.

If this is correct, please click on the following link to change it:
###ADMIN_URL###

You can safely ignore and delete this email if you do not want to
take this action.

This email has been sent to ###EMAIL###

Regards,
All at ###SITENAME###
###SITEURL###Howdy USERNAME,

Your new SITE_NAME site has been successfully set up at:
BLOG_URL

You can log in to the administrator account with the following information:

Username: USERNAME
Password: PASSWORD
Log in here: BLOG_URLwp-login.php

We hope you enjoy your new site. Thanks!

--The Team @ SITE_NAMEHowdy USERNAME,

Your new account is set up.

You can log in with the following information:
Username: USERNAME
Password: PASSWORD
LOGINLINK

Thanks!

--The Team @ SITE_NAMEHowdy!

WordPress has a built-in feature that detects when a plugin or theme causes a fatal error on your site, and notifies you with this automated email.
###CAUSE###
First, visit your website (###SITEURL###) and check for any visible issues. Next, visit the page where the error was caught (###PAGEURL###) and check for any visible issues.

###SUPPORT###

If your site appears broken and you can't access your dashboard normally, WordPress now has a special "recovery mode". This lets you safely login to your dashboard and investigate further.

###LINK###

To keep your site safe, this link will expire in ###EXPIRES###. Don't worry about that, though: a new link will be emailed to you if the error occurs again after it expires.

When seeking help with this issue, you may be asked for some of the following information:
###DEBUG###

###DETAILS###Howdy,

A request has been made to perform the following action on your account:

     ###DESCRIPTION###

To confirm this, please click on the following link:
###CONFIRM_URL###

You can safely ignore and delete this email if you do not want to
take this action.

Regards,
All at ###SITENAME###
###SITEURL###Howdy,

A user data privacy request has been confirmed on ###SITENAME###:

User: ###USER_EMAIL###
Request: ###DESCRIPTION###

You can view and manage these data privacy requests here:

###MANAGE_URL###

Regards,
All at ###SITENAME###
###SITEURL###Howdy,

Your request to erase your personal data on ###SITENAME### has been completed.

If you have any follow-up questions or concerns, please contact the site administrator.

For more information, you can also read our privacy policy: ###PRIVACY_POLICY_URL###

Regards,
All at ###SITENAME###
###SITEURL###Howdy,

Your request to erase your personal data on ###SITENAME### has been completed.

If you have any follow-up questions or concerns, please contact the site administrator.

Regards,
All at ###SITENAME###
###SITEURL###Howdy, %sHowever, you can still <a href="%s">activate this theme</a>, and use the Site Editor to customize it.Human readable text for the author.Human-readable labels for the post type for various contexts.Human-readable labels for the taxonomy for various contexts.Human-readable name identifying the widget type.HungarianHurray! Your theme supports site editing with blocks. <a href="%1$s">Tell me more</a>. %2$sI really need an ID for this to work.ID of global styles config.ID of sidebar.ID of template.ID of the post context.IE conditional comments are ignored by all supported browsers.IO error.IPIP address for the comment author.IcelandicIconIcon content does not contain valid SVG markup.Icon content must be a string.Icon label must be a string.Icon name must be a string.Icon name.Icon not found: "%s".Icon of block type.Icons must provide either `content` or `filePath`.Id for link anchor (TinyMCE)IdId should start with a letter, followed only by letters, numbers, dashes, dots, colons or underscores.If the value is a string, the value will be used as the archive slug. If the value is false the post type has no archive.If this was a mistake, ignore this email and nothing will happen.If you add a video, the image will be used as a fallback while the video loads.If you are looking to paste rich content from Microsoft Word, try turning this option off. The editor will clean up text pasted from Word automatically.If you are not going to use a great site domain, leave it for a new user. Now have at it!If you are still stuck with this message, then check that your database contains the following tables:If you are the owner of this network please check that your host&#8217;s database server is running properly and all tables are error free.If you are unsure what these terms mean you should probably contact your host. If you still need help you can always visit the <a href="%s">WordPress support forums</a>.If you do not activate your site within two days, you will have to sign up again.If you do not activate your username within two days, you will have to sign up again.If you do not know how to set up a database you should <strong>contact your host</strong>. If all else fails you may find help at the <a href="%s">WordPress support forums</a>.If you have not received your email yet, there are a number of things you can do:If your site does not display, please contact the owner of this network.If your theme has multiple menus, giving them clear names will help you manage them.If your theme has widget areas, you can also add menus there. Visit the <a href="%s">Widgets panel</a> and add a &#8220;Navigation Menu widget&#8221; to display a menu in a sidebar or footer.ImageImage <span class="count">(%s)</span>Images <span class="count">(%s)</span>Image CSS ClassImage Editor Save FailedImage PositionImage SizeImage Title AttributeImage URLImage WidgetImage Widget (%d)Image Widget (%d)Image crop area preview. Requires mouse interaction.Image crop failed.Image default alignImage default link typeImage default sizeImage descriptionImage detailsImage edit.Image flip failed.Image resize failed.Image rotate failed.Image size in pixelsImagesIn %1$s, use the %2$s method, not the %3$s function. See %4$s.In reply to %s.In reply to: %sIn the editing area, the Tab key enters a tab character.In this case, WordPress caught an error with one of your plugins, %s.In this case, WordPress caught an error with your theme, %s.Inactive widgetsIncorrect post password.Incorrect username or password.Increase indentIndicates if a template is custom or part of the template hierarchyIndicates whether the current variation is the default one.IndonesianInexistent terms.Inline CSS code that registers the CSS class required for the style.Inline toolbar (when an image, link or preview is selected)Input parameters for the ability execution.Insert Page Break tagInsert Read More tagInsert audio playlistInsert column afterInsert column beforeInsert date/timeInsert from URLInsert galleryInsert imageInsert into Navigation MenuInsert into pageInsert into postInsert into templateInsert into template partInsert linkInsert row afterInsert row beforeInsert tableInsert videoInsert video playlistInsert/edit code sampleInsert/edit imageInsert/edit linkInsert/edit mediaInserted textInstallInstall &amp; PreviewInstall and preview theme: %sInstall from Google Fonts. Fonts are copied to and served from your site.Installed themesInstance settings of the widget, if supported.Insufficient arguments passed to this XML-RPC method.Interactivity directives were detected inside an incompatible %1$s tag. These directives will be ignored in the server side render.Interactivity directives were detected on an incompatible %1$s tag when processing "%2$s". These directives will be ignored in the server side render.Internal search handler error.Introduce yourself.InvalidInvalid Content-Disposition supplied. Content-Disposition needs to be formatted as `attachment; filename="image.png"` or similar.Invalid JSON body passed.Invalid JSONP callback function.Invalid URLInvalid URL pattern context %s.Invalid URL.Invalid action name.Invalid activation key.Invalid address: Invalid arguments passed to this XML-RPC method. Requires two integers.Invalid attachment ID.Invalid attribute name.Invalid author ID.Invalid block type.Invalid block.Invalid changeset UUIDInvalid comment ID.Invalid comment author ID.Invalid comment content.Invalid comment status.Invalid cookie format.Invalid cookie.Invalid date.Invalid email address.Invalid featured media ID.Invalid fetchpriority `%1$s` defined for `%2$s` during script registration.Invalid fetchpriority: %sInvalid header name or valueInvalid hex color.Invalid host entry: Invalid host: Invalid icon property: "%s".Invalid item ID.Invalid key.Invalid menu ID.Invalid menu location.Invalid object ID.Invalid object type.Invalid page template.Invalid parameter(s): %sInvalid parameter.Invalid parameters.Invalid parent type.Invalid password.Invalid personal data request.Invalid post ID.Invalid post format.Invalid post parent ID.Invalid post type.Invalid post.Invalid recovery key format.Invalid recovery key.Invalid request status.Invalid revision ID.Invalid role.Invalid shortcode name: %1$s. Do not use spaces or reserved characters: %2$sInvalid shortcode name: Empty name given.Invalid slug.Invalid status.Invalid strategy `%1$s` defined for `%2$s` during script registration.Invalid taxonomy.Invalid taxonomy: %s.Invalid template parent ID.Invalid term ID.Invalid term name.Invalid type parameter.Invalid user ID for reassignment.Invalid user ID.Invalid user parameter(s).Invalid value %1$s for %2$s. Expected value should be between %3$s and %4$s.Invalid value for background attachment.Invalid value for background position X.Invalid value for background position Y.Invalid value for background repeat.Invalid value for background size.Invalid value.Invalid widget type.IrishIs the block dynamically rendered.Is there no link to us?It does not look like your site has any menus yet. Want to build one? Click the button to start.It looks like nothing was found at this location. Maybe try visiting %s directly?It looks like the response did not come from this site.ItalianItalicItem added.Items deleted.JSON Schema for the ability input.JSON Schema for the ability output.JSONP support is disabled on this site.JanuaryJanuary abbreviationJanJapaneseJavaScript must be enabled to use this feature.JulyJuly abbreviationJulJump to footnote reference %1$dJuneJune abbreviationJunJust a username, please.JustifyKebab-case unique identifier for the font family preset.Keep widget settings and move it to the inactive widgetsKeyboard ShortcutsKeywordKeywordsKoreanLanguageLargeLarge size image heightLarge size image widthLast LoginLast ModifiedLast PostLast name for the user.Last pageLast updatedLast updated: %sLatitudeLatvianLayoutLearn WordPressLearn moreLearn more about CSSLearn more about XML sitemaps.Learn more about troubleshooting WordPress.Leave a CommentLeave a ReplyLeave a Reply to %sLeftLength:LetterLimit response to comments published after a given ISO8601 compliant date.Limit response to comments published before a given ISO8601 compliant date.Limit response to posts modified after a given ISO8601 compliant date.Limit response to posts modified before a given ISO8601 compliant date.Limit response to posts published after a given ISO8601 compliant date.Limit response to posts published before a given ISO8601 compliant date.Limit result set based on relationship between multiple taxonomies.Limit result set to all items except those of a particular parent ID.Limit result set to attachments of a particular MIME type or MIME types.Limit result set to attachments of a particular media type or media types.Limit result set to blocks matching the search term.Limit result set to comments assigned a specific status. Requires authorization.Limit result set to comments assigned a specific type. Requires authorization.Limit result set to comments assigned to specific post IDs.Limit result set to comments assigned to specific user IDs. Requires authorization.Limit result set to comments of specific parent IDs.Limit result set to items assigned one or more given formats.Limit result set to items except those with specific terms assigned in the %s taxonomy.Limit result set to items that are sticky.Limit result set to items with particular parent IDs.Limit result set to items with specific terms assigned in the %s taxonomy.Limit result set to posts assigned one or more statuses.Limit result set to posts assigned to specific authors.Limit result set to posts with a specific menu_order value.Limit result set to posts with one or more specific slugs.Limit result set to specific IDs.Limit result set to terms assigned to a specific parent.Limit result set to terms assigned to a specific post.Limit result set to terms with one or more specific slugs.Limit result set to that from a specific author email. Requires authorization.Limit result set to themes assigned one or more statuses.Limit result set to users matching at least one specific capability provided. Accepts csv list or single capability.Limit result set to users matching at least one specific role provided. Accepts csv list or single role.Limit result set to users who are considered authors.Limit result set to users who have published posts.Limit result set to users with one or more specific slugs.Limit results to abilities in specific ability category.Limit results to items of an object type.Limit results to items of one or more object subtypes.Limit results to taxonomies associated with a specific post type.Limit results to those matching a category ID.Limit results to those matching a keyword ID.Limit results to those matching a pattern (slug).Limit results to those matching a string.Limit to the specified post id.Limit to the specified template part area.Limits results to plugins with the given status.LinkLink CSS ClassLink CategoriesLink CategoryLink IDLink RelLink Relationship (XFN)Link TextLink ToLink anchor (TinyMCE)AnchorLink anchors (TinyMCE)AnchorsLink inserted.Link optionsLink ratingLink selected.Link titleLink to Attachment PageLink to Media FileLink to:LinksLinks for %sLinks widgetRandomList itemList of available font weights, separated by a space.List of the missing image sizes of the attachment.List viewLithuanianLive BroadcastLive PreviewLive Preview: %sLive preview theme: %sLoaded version '%1$s' incompatible with expected version '%2$s'.Loading more results... please wait.Loading page, please wait.Locale for the user.Log InLog OutLog inLog in to ReplyLog in to leave a CommentLog outLogged in as %1$s. <a href="%2$s">Edit your profile</a>. <a href="%3$s">Log out?</a>Login Address (URL)Login name for the user.Login, RSS, &amp; WordPress.org links.LogoLongitudeLooking for a theme? You can search or browse the WordPress.org theme directory, install and preview themes, then activate them right here.Looks like something&#8217;s gone wrong. Wait a couple seconds, and then try again.Looks like this is not the correct kind of file. Please link to an appropriate file instead.Looks like this is not the correct kind of file. Please link to an audio file instead.LoopLost PasswordLost your password?M j, Y g:i aMacedonianMaintenanceMalayMalteseManage ArchivesManage AudioManage CommentsManage DocumentsManage ImagesManage SiteManage SpreadsheetsManage VideoManual OffsetsMarchMarch abbreviationMarMatch caseMatch terms with the listed IDs.Matt MullenwegMaximum number of items to be returned in result set.Maximum posts per pageMaximum upload file size: %s.MayMay abbreviationMayMediaMedia FileMedia LibraryMedia WidgetMedia Widget (%d)Media Widget (%d)Media item link optionNoneMedia listMedia titleMedia title&hellip;MediumMedium size image heightMedium size image widthMedium-Large size image heightMedium-Large size image widthMemory exceeded. Please try another smaller file.MenuMenu ItemMenu LocationMenu LocationsMenu NameMenu OptionsMenu createdMenu deletedMenu item addedMenu item deletedMenu item is now a sub-itemMenu item moved downMenu item moved out of submenuMenu item moved upMenu items do not support trashing. Set '%s' to delete.MenusMenus can be displayed in locations defined by your theme or in <a href="%s">widget areas</a> by adding a &#8220;Navigation Menu&#8221; widget.Menus can be displayed in locations defined by your theme.Menus do not support trashing. Set '%s' to delete.Merge table cellsMeridianMessage body emptyMetaMeta fields.Meta information about the ability.Meta information about the category.Meta keys cannot enable revisions support unless the object subtype supports revisions.Meta keys cannot enable revisions support unless the object type supports revisions.MetadataMethod %1$s does not exist on %2$s.Method '%s' must be overridden.Method '%s' not implemented. Must be overridden in subclass.MiddleMinimum required version of PHP.Minimum required version of WordPress.MinuteMissing AttachmentMissing confirm key.Missing menu name.(unnamed)Missing parameter(s): %sMissing request ID.Missing required id key in entry among dependencies array.Missing required inputs to pre-computed WP_Token_Map.Mission complete. Message %s deleted.MonMondayMonday initialMMonthMove downMove down oneMove one level downMove one level upMove out from under %sMove to TrashMove to another area&hellip;Move to the topMove under %sMove upMove up oneMove widgetMoveMulti-column patterns with more complex layouts.Must be at least 4 characters, letters and numbers only. It cannot be changed, so choose carefully!MuteMy SitesNameName for the Code editor tab (formerly Text)CodeName for the Visual editor tabVisualName of link anchor (TinyMCE)NameName of the font family preset, translatable.Namespace must not start or end with a slash. Instead namespace '%1$s' for route '%2$s' seems to contain a slash.Namespace or reference path cannot be empty. Directive value referenced: %sNav menu locations must be strings.NavigationNavigation LabelNavigation MenuNavigation Menu ItemNavigation Menu ItemsNavigation Menu archivesNavigation Menu updated.Navigation MenusNavigation Menus listNavigation Menus list navigationNavigation OverlayNavigation menus that can be inserted into your site.Need more help? <a href="%1$s">Read the support article on %2$s</a>.Nested widgets.Network AdminNetwork Admin: %sNetwork error occurred while sending %1$s request to %2$s: %3$sNetwork error occurred while sending request to %1$s: %2$sNetwork only plugin must be network activated.New %1$s Site: %2$sNew %1$s User: %2$sNew Category NameNew ChangesetNew Custom HTML WidgetNew Link Category NameNew MenuNew Navigation MenuNew PageNew PatternNew Pattern Category NameNew PostNew Site Registration: %sNew Site: %1$s
URL: %2$s
Remote IP address: %3$s

Disable these notifications: %4$sNew Tag NameNew TemplateNew Template PartNew User Registration: %sNew User: %1$s
Remote IP address: %2$s

Disable these notifications: %3$sNew comment on your post "%s"New documentNew note on your post "%s"New page titleNew passwordNew pingback on your post "%s"New site created by %1$s

Address: %2$s
Name: %3$sNew site notification email subject[%1$s] Activate %2$sNew trackback on your post "%s"New user notification email subject[%1$s] Activate %2$sNew user registration on your site %s:New version available.New version available. %sNew windowNewer CommentsNewer Comments &raquo;Newer commentsNewer postsNextNext &gt;Next &raquo;Next PageNext Page &raquo;Next PostNext pageNicename may not be longer than 50 characters.NoNo %1$s was set in the arguments array for the "%2$s" sidebar. Defaulting to "%3$s". Manually set the %1$s to "%3$s" to silence this notice and keep existing sidebar content.No Classic Menus found.No CommentsNo Comments<span class="screen-reader-text"> on %s</span>No Content-Disposition supplied.No Content-Type supplied.No Navigation Menu found in Trash.No Navigation Menu found.No alignmentNo archives to show.No audio selectedNo categoriesNo categories found.No changes saved yet, so there is nothing to trash.No changeset found to take overNo changesets found in Trash.No changesets found.No colorNo commentsNo comments to show.No comments<span class="screen-reader-text"> on %s</span>No cookie present.No data supplied.No editor could be selected.No fallback menu found.No file selectedNo global styles config exists with that ID.No image selectedNo images selectedNo itemsNo items found.No logo selectedNo matching template foundNo matching template found.No media items found.No media items found. Try a different search.No media selectedNo menus have been created yet. <a href="%s">Create some</a>.No pages found in Trash.No pages found.No pattern categoriesNo pattern categories found.No patterns found in Trash.No patterns found.No plugin specified.No posts found in Trash.No posts found or an error occurred while retrieving posts.No posts found.No registered block metadata collection was found for the provided path.No results found.No route was found matching the URL and request method.No search term specified. Showing recent items.No sidebar exists with that id.No tagsNo tags found.No template parts found in Trash.No template parts found.No templates exist with that id.No templates found in Trash.No templates found.No theme is defined for this template.No themes found. Try a different search, or %s.No themes found. Try a different search.No valid context element was detected.No video selectedNo widget was found with that id.No widgets found.Non-empty string required for id.Non-existent changeset UUID.Nonbreaking spaceNoneNorwegianNot an ability function callNot availableNot enough data to create this user.Not enough space to upload. %s KB needed.Not found: %1$s (%2$s)Note resolution statusNote: %sNotificationsNovemberNovember abbreviationNovNumber of URLs in this XML Sitemap: %s.Number of comments to show:Number of items found: %dNumber of links to show:Number of media items found: %dNumber of posts to show:Number of published posts for the term.Number of widgets found: %dNumbered listOKObject ID must be an integer, %s given.Object subtype.Object type.OctoberOctober abbreviationOctOffset the result set by a specific number of items.Older CommentsOlder commentsOlder postsOn some systems the name of your database is prefixed with your username, so it would be like <code>username_%1$s</code>. Could that be the problem?Once DailyOnce HourlyOnce WeeklyOne or more database tables are unavailable. The database may need to be <a href="%s">repaired</a>.One responseOne response to %sOne response to &#8220;%s&#8221;Only %1$s or %2$s files may be used for header video. Please convert your video file and try again, or, upload your video to YouTube and link it with the option below.Only UUID V4 is supported at this time.Only a static class method or function can be used in an uninstall hook.Oops! That embed cannot be found.Oops: %sOpen Sans font: add new subset (greek, cyrillic, vietnamese)no-subsetOpen Sans font: on or offonOpen command paletteOpen link in a new tabOpen menuOpen sharing dialogOptionalOptional: Limit response to specific fields. If omitted, all fields are returned.Or link to existing contentOr, enter a YouTube URL:OrangeOrderOrder sort attribute ascending or descending.Original SizeOriginalOriginal attachment file name.Original image:Original: %sOut from under %sOverride the default excerpt length.OverviewPDF embedPHP version %sPHP's XML extension is not available. Please contact your hosting provider to enable PHP's XML extension.PMPagePage %sPage ArchivesPage AttributesPage IDPage IDs, separated by commas.Page Loaded.Page breakPage not foundPage on frontPage orderPage published privately.Page published.Page reverted to draft.Page scheduled.Page titlePage trashed.Page updated.PagesPages listPages list navigationPages:PaginationParagraphParentParent CategoryParent Category:Parent Navigation Menu:Parent Page:Parent Template Part:Parent Template:Parent blocks.Parent term does not exist.Partial render must echo the content or return the content string (or array), but not both.Passing an integer number of posts is deprecated. Pass an array of arguments instead.PasswordPassword ResetPassword changed for user: %sPassword for the user (never included).Password protectedPassword reset is not allowed for this userPassword:Passwords cannot be empty.Passwords cannot contain the "%s" character.PastePaste URL or type to searchPaste as textPaste is now in plain text mode. Contents will now be pasted as plain text until you toggle this option off.Paste table row afterPaste table row beforePaste your embed code below:Paths or URLs to the font files.Pattern "%s" not found.Pattern Categories listPattern Categories list navigationPattern Category LinkPattern content must be a string.Pattern name must be a string.Pattern published privately.Pattern published.Pattern reverted to draft.Pattern scheduled.Pattern title must be a string.Pattern updated.Patterns containing mostly text.Patterns listPatterns list navigationPatterns that contain buttons and call to actions.PausePendingPending <span class="count">(%s)</span>Pending <span class="count">(%s)</span>Pending ReviewPerform an advanced term query.Permalink template for the post.Permalink:Permalink: %sPersianPhotobloggingPingbackPingback excerpt: Pingback from %1$s to %2$s registered. Keep the web talking! :-)Pingback:PinkPlayPlaylist SettingsPlease check that the %s PHP extension is installed and enabled.Please consider writing more inclusive code.Please contact the plugin authors for more information.Please contact your host for assistance with investigating this issue further.Please contact your network administrator.Please enter a page titlePlease enter a site name.Please enter a site title.Please enter a username.Please enter a valid YouTube URL.Please enter a valid email address.Please enter an item titlePlease enter your username or email address. You will receive an email message with instructions on how to reset your password.Please include a %s template in your theme.Please log in again.Please log in to %1$s to authorize %2$s to connect to your account.Please log in to %s to proceed with authorization.Please pass a query array to this function.Please provide a valid link.Please save your changes in order to share the preview.Please see <a href="%s">Debugging in WordPress</a> for more information.Please try again.Please try uploading this file with the %1$sbrowser uploader%2$s.Please use %s to add new schema properties.Please verify that the <strong>administration email</strong> for this website is still correct.Plugin author's website address.Plugin not found.Plugin that registered the template.PluginsPolishPopular Pattern CategoriesPopular TagsPortuguesePositionPostPost ArchivesPost AttributesPost CommentPost Format LinkPost ID.Post ThumbnailPost Type ArchivePost Type: &#8220;%s&#8221;Post custom field name%s:Post formatAsidePost formatAudioPost formatChatPost formatGalleryPost formatImagePost formatLinkPost formatQuotePost formatStandardPost formatStatusPost formatVideoPost formats supported.Post navigationPost published privately.Post published.Post reverted to draft.Post scheduled.Post trashed.Post type names must be between 1 and 20 characters in length.Post type to get the templates for.Post updated.Posted title:PosterPoster ImagePostsPosts PagePosts by %sPosts listPosts list navigationPosts navigationPosts pagePosts paginationPosts published on %sPowered by WordPressPreloadPreload valueNonePreview LinkPreview as a browser iconPreview as an app iconPreview link for the post.Previewing themePrevious PagePrevious PostPrevious and next monthsPrevious pagePrintPriorityPrivacy PolicyPrivacy:PrivatePrivate <span class="count">(%s)</span>Private <span class="count">(%s)</span>Private: %sPrompt execution was prevented by a filter.Property "%1$s" is not a valid property for ability "%2$s". Please check the %3$s class for allowed properties.Property "%1$s" is not a valid property for ability category "%2$s". Please check the %3$s class for allowed properties.Protect your site from spam.Protected Comments: Please enter your password to view comments.Protected: %sProvider logo path must be located within the plugins or must-use plugins directory.PublicPublic facing and editor script handle. DEPRECATED: Use `script_handles` instead.Public facing and editor script handles.Public facing and editor style handle. DEPRECATED: Use `style_handles` instead.Public facing and editor style handles.Public facing script handle. DEPRECATED: Use `view_script_handles` instead.Public facing script handles.Public facing script module IDs.Public facing style handles.Public text domain.PublishPublish SettingsPublishedPublished <span class="count">(%s)</span>Published <span class="count">(%s)</span>PurpleQuery parameter not permitted: %sQuick EditQuote from Hello Dolly song, by Jerry Herman:REST API %1$s should be an array of arrays. Non-array value detected for %2$s.REST API resource link nameJSONREST API routes must be registered on the %1$s action. Instead route '%2$s' with namespace '%3$s' was not registered on this action.REST base route for the post type.REST base route for the taxonomy.REST namespace route for the taxonomy.REST route's namespace for the post type.REST search handlers must extend the %s class.RSSRSS Error:RSS FeedRandom OrderRandomize suggested headersRandomize uploaded headersRandomizing suggested headersRandomizing uploaded headersRange of minutes to read%1$s–%2$s minutesRaw size value must be a string, integer, or float.Read moreRead more...Read the <a href="%s" target="_blank">Debugging a WordPress Network</a> article. Some of the suggestions there may help you figure out what went wrong.Read-only abilities require GET method.Reassign the deleted user's posts and links to this user ID.Recent CommentsRecent PostsRecovery Mode &#8212; %sRecovery Mode Initialized. Please log in to continue.Recovery Mode not initialized.Recovery key expired.RedRedoRegisterRegister For This SiteRegistration FormRegistration complete. Please check your email, then visit the <a href="%s">login page</a>.Registration confirmation will be emailed to you.Registration date for the user.Registration has been disabled.Remember MeRemind me laterRemoveRemove Menu Item: %1$s (%2$s)Remove audio sourceRemove imageRemove linkRemove poster imageRemove video sourceRemovedRemoving %1$s manually will cause PHP warnings. Use the %2$s filter instead.ReorderReorder menu itemsReorder mode closedReorder mode enabledReorder widgetsRepeat Background ImageRepeat ImageRepeatReplaceReplace audioReplace imageReplace videoReply to %sRequired fields are marked %sRequired to be true, as revisions do not support trashing.Required to be true, as terms do not support trashing.Required to be true, as users do not support trashing.Requirements Not MetReset PasswordResponseResponse to &#8220;%s&#8221;ResponsesResponses to &#8220;%s&#8221;Responsive LayoutRestoreRestore from TrashRestore last draftRestore the backupRetryReturn a %1$s or %2$s object from your callback when using the REST API.Returns basic profile details for the current authenticated user to support personalization, auditing, and access-aware behavior.Returns core details about the site's runtime context for diagnostics and compatibility (environment, PHP runtime, database server info, WordPress version).Returns site information configured in WordPress. By default returns all fields, or optionally a filtered subset.Reverse orderReverting unpublished changes&hellip;RevisionRevisionsRevisions do not support trashing. Set '%s' to delete.Revisions not enabled.Rich Text Area. Press Alt-Shift-H for help.Rich Text Area. Press Control-Option-H for help.RightRobotsRoles assigned to the user.RomanianRotationRotation arguments.Rotation type.Route must be specified. Instead within the namespace '%1$s', there seems to be an empty route '%2$s'.Routes must be namespaced with plugin or theme name and version. Instead there seems to be an empty namespace '%1$s' for route '%2$s'.RowRow groupRow typeRowsRussianSMTP Error: Could not authenticate.SMTP Error: Could not connect to SMTP host.SMTP Error: Data not accepted.SMTP Error: The following recipients failed: SMTP code: SMTP connect() failed.SMTP server error: SSL verification failed.SatSaturdaySaturday initialSSaveSave &amp; PublishSave DraftSave PasswordSave and preview changes before publishing them.Save my name, email, and website in this browser for the next time I comment.SavedSaved.Schedule your customization changes to publish ("go live") at a future date.ScheduledScheduled <span class="count">(%s)</span>Scheduled <span class="count">(%s)</span>Scope under which the request is made; determines fields present in response.Scrape key check failed. Please try again.Screen reader users: when in forms mode, you may need to press the Esc key twice.Scripts and styles should not be registered or enqueued until the %1$s, %2$s, or %3$s hooks.Scroll with PageSearchSearch CategoriesSearch ChangesetsSearch Link CategoriesSearch Menu ItemsSearch Navigation MenusSearch PagesSearch Pattern CategoriesSearch PatternsSearch PostsSearch Results %1$s %2$sSearch Results for &#8220;%s&#8221;Search TagsSearch Template PartsSearch TemplatesSearch WidgetsSearch WordPress.org themesSearch mediaSearch media items...Search or use up and down arrow keys to select an item.Search resultsSearch results for: "%s"Search results for: &#8220;%s&#8221;Search themesSearch widgetSearchSeasonalSections whose purpose is to trigger a specific action.Security check failed.Security error.See how changes would look live on your website, and share the preview with people who can't access the Customizer.SelectSelect %sSelect CategorySelect DaySelect FilesSelect Link Category:Select Menu:Select MonthSelect PostSelect Site IconSelect WeekSelect YearSelect a citySelect allSelect an area to move this widget into:Select and cropSelect audioSelect fileSelect imageSelect logoSelect poster imageSelect videoSelected media actionsSeparate pattern categories with commasSeparate tags with commasSeptemberSeptember abbreviationSepSerbianSerialized widget form data to encode into instance settings.Server does not support SMTPUTF8 needed to send to Unicode addressesSession TokensSession expiredSet imageSetting does not exist or is unrecognized.Setting up your live preview. This may take a bit.SettingsShadow nameCrispShadow nameDeepShadow nameNaturalShadow nameOutlinedShadow nameSharpShare Preview LinkShare reviews and feedback about your brand/business.Sharing optionsShift + Alt + letter:Shift-click to edit this element.Shift-click to edit this widget.Short for blue in RGBBShort for green in RGBGShort for red in RGBRShortlinkShowShow Artist Name in TracklistShow ImagesShow Link DescriptionShow Link ImageShow Link NameShow Link RatingShow TracklistShow Video ListShow hierarchyShow invisible charactersShow on frontShow passwordShow post countsShow tag countsShowcase your latest work.Showing details for theme: %sSidebarSidebar %dSign upSigning Error: SilverSingle item: %sSiteSite %dSite Address (URL)Site AdminSite Domain (subdomain only):Site ID must not be empty.Site IconSite IdentitySite Language:Site Name (subdirectory only):Site Name: %sSite PreviewSite TaglineSite TitleSite Title:Site URL.Site does not exist.Site domain must not be empty.Site icon.Site logo.Site name must be at least %s character.Site name must be at least %s characters.Site names can only contain lowercase letters (a-z) and numbers.Site network ID must be provided.Site path must not be empty.Site registration has been disabled.Site tagline.Site title.Site with the ID does not exist.SitesSites you are already a member of:SizeSkip croppingSkip to contentSkip to toolbarSlovakSlovenianSlow down, no need to check for new mails so often!SlugSlug automatically generated from the post title.SmallSoftware NameSoftware VersionSome HTML tags are not permitted, including:Some of the %1$s %2$s values are invalidSome required plugins are missing or inactive.Someone has requested a password reset for the following account:Sorry, comments are closed for this item.Sorry, comments are not allowed for this item.Sorry, deleting the term failed.Sorry, editing the term failed.Sorry, marking a user as spam is only supported on Multisite.Sorry, new registrations are not allowed at this time.Sorry, no such page.Sorry, no such post.Sorry, one of the given taxonomies is not supported by the post type.Sorry, replies to unapproved comments are not allowed.Sorry, revisions are disabled.Sorry, site names must have letters too!Sorry, that email address is already used!Sorry, that email address is not allowed!Sorry, that site already exists!Sorry, that site is reserved!Sorry, that username already exists!Sorry, that username is not allowed.Sorry, the category could not be created.Sorry, the comment could not be updated.Sorry, the post could not be created.Sorry, the post could not be deleted.Sorry, the post could not be updated.Sorry, the term could not be created.Sorry, the user could not be updated.Sorry, the video at the supplied URL cannot be loaded. Please check that the URL is for a supported video file (%s) or stream (e.g. YouTube and Vimeo).Sorry, this method is not supported.Sorry, this post type does not support notes.Sorry, trackbacks are closed for this item.Sorry, usernames must have letters too!Sorry, you are not allowed to access details about this site.Sorry, you are not allowed to access details of this post.Sorry, you are not allowed to access font collections.Sorry, you are not allowed to access font faces.Sorry, you are not allowed to access font families.Sorry, you are not allowed to access the global styles on this site.Sorry, you are not allowed to access the templates on this site.Sorry, you are not allowed to access this font face.Sorry, you are not allowed to access this font family.Sorry, you are not allowed to access user data on this site.Sorry, you are not allowed to activate plugins.Sorry, you are not allowed to activate this plugin.Sorry, you are not allowed to add a category.Sorry, you are not allowed to add a term to one of the given taxonomies.Sorry, you are not allowed to assign a term to one of the given taxonomies.Sorry, you are not allowed to assign terms in this taxonomy.Sorry, you are not allowed to assign the provided terms.Sorry, you are not allowed to assign this term.Sorry, you are not allowed to browse the block directory.Sorry, you are not allowed to browse the local block pattern directory.Sorry, you are not allowed to change the comment type.Sorry, you are not allowed to change the page author as this user.Sorry, you are not allowed to change the post author as this user.Sorry, you are not allowed to comment on this post.Sorry, you are not allowed to create Navigation Menus as this user.Sorry, you are not allowed to create a comment on this post.Sorry, you are not allowed to create application passwords for this user.Sorry, you are not allowed to create new users.Sorry, you are not allowed to create notes for this post.Sorry, you are not allowed to create pages as this user.Sorry, you are not allowed to create password protected posts in this post type.Sorry, you are not allowed to create posts as this user.Sorry, you are not allowed to create private posts in this post type.Sorry, you are not allowed to create terms in this taxonomy.Sorry, you are not allowed to create this comment without a post.Sorry, you are not allowed to customize this site.Sorry, you are not allowed to deactivate this plugin.Sorry, you are not allowed to delete application passwords for this user.Sorry, you are not allowed to delete plugins for this site.Sorry, you are not allowed to delete revisions of this post.Sorry, you are not allowed to delete this application password.Sorry, you are not allowed to delete this category.Sorry, you are not allowed to delete this comment.Sorry, you are not allowed to delete this page.Sorry, you are not allowed to delete this post.Sorry, you are not allowed to delete this revision.Sorry, you are not allowed to delete this term.Sorry, you are not allowed to delete this user.Sorry, you are not allowed to do that.Sorry, you are not allowed to edit '%s' for comments.Sorry, you are not allowed to edit Navigation Menus as this user.Sorry, you are not allowed to edit comments.Sorry, you are not allowed to edit pages.Sorry, you are not allowed to edit posts in this post type.Sorry, you are not allowed to edit posts.Sorry, you are not allowed to edit roles of this user.Sorry, you are not allowed to edit terms in this taxonomy.Sorry, you are not allowed to edit the %s custom field.Sorry, you are not allowed to edit theme options on this site.Sorry, you are not allowed to edit this application password.Sorry, you are not allowed to edit this comment.Sorry, you are not allowed to edit this global style.Sorry, you are not allowed to edit this page.Sorry, you are not allowed to edit this post.Sorry, you are not allowed to edit this term.Sorry, you are not allowed to edit this user.Sorry, you are not allowed to edit users.Sorry, you are not allowed to edit your profile.Sorry, you are not allowed to execute this ability.Sorry, you are not allowed to export templates and template parts.Sorry, you are not allowed to filter users by capability.Sorry, you are not allowed to filter users by role.Sorry, you are not allowed to give users that role.Sorry, you are not allowed to install plugins on this site.Sorry, you are not allowed to list application passwords for this user.Sorry, you are not allowed to list users.Sorry, you are not allowed to make posts sticky.Sorry, you are not allowed to make proxied oEmbed requests.Sorry, you are not allowed to manage application passwords for this user.Sorry, you are not allowed to manage block types.Sorry, you are not allowed to manage network plugins.Sorry, you are not allowed to manage plugins for this site.Sorry, you are not allowed to manage post statuses.Sorry, you are not allowed to manage terms in this taxonomy.Sorry, you are not allowed to manage this plugin.Sorry, you are not allowed to manage widgets on this site.Sorry, you are not allowed to moderate or edit this comment.Sorry, you are not allowed to order users by this parameter.Sorry, you are not allowed to post on this site.Sorry, you are not allowed to preview drafts.Sorry, you are not allowed to process remote URLs.Sorry, you are not allowed to publish pages on this site.Sorry, you are not allowed to publish posts in this post type.Sorry, you are not allowed to publish posts on this site.Sorry, you are not allowed to publish this page.Sorry, you are not allowed to publish this post.Sorry, you are not allowed to query users by this parameter.Sorry, you are not allowed to read blocks as this user.Sorry, you are not allowed to read blocks of this post.Sorry, you are not allowed to read comments without a post.Sorry, you are not allowed to read the post for this comment.Sorry, you are not allowed to read this application password.Sorry, you are not allowed to read this comment.Sorry, you are not allowed to take over.Sorry, you are not allowed to update options.Sorry, you are not allowed to update posts as this user.Sorry, you are not allowed to upload files.Sorry, you are not allowed to upload media on this site.Sorry, you are not allowed to upload media to this post.Sorry, you are not allowed to upload this file type.Sorry, you are not allowed to view autosaves of this post.Sorry, you are not allowed to view menu items.Sorry, you are not allowed to view menu locations.Sorry, you are not allowed to view menus.Sorry, you are not allowed to view revisions of this post.Sorry, you are not allowed to view terms for this post.Sorry, you are not allowed to view the active theme.Sorry, you are not allowed to view the registered block pattern categories.Sorry, you are not allowed to view the registered block patterns.Sorry, you are not allowed to view the registered icons.Sorry, you are not allowed to view themes.Sorry, you are not allowed to view this global style.Sorry, you are not allowed to view this item.Sorry, you cannot preview new themes when you have changes scheduled or saved as a draft. Please publish your changes, or wait until they publish to preview new themes.Sorry, you cannot stick a private post.Sorry, you have used your space allocation of %s. Please delete some files to upload more files.Sorry, you may not use that site name.Sorry, you must be able to edit posts on this site in order to view categories.Sorry, you must be able to edit posts on this site in order to view tags.Sorry, you must be logged in to comment.Sort by:Sort collection by comment attribute.Sort collection by object attribute.Sort collection by post attribute.Sort collection by term attribute.Sort collection by user attribute.SourceSource codeSource of a customized templateSource of templateSpam it: %sSpanishSpecial characterSplit table cellSpreadsheet <span class="count">(%s)</span>Spreadsheets <span class="count">(%s)</span>SpreadsheetsState of the comment.StatusStatus is forbidden.Status of sidebar.Status of template.StickyStill waiting for your email?Strength indicatorStrikethroughStyleStyle VariationsStylesheetStylesheet is missing.Stylesheet is not readable.SubmitSubmit SearchSubmit for ReviewSubscriptSuggested image dimensions: %1$s by %2$s pixels.SunSundaySunday initialSSuperscriptSupportSwahiliSwedishTable cell propertiesTable of ContentsTable propertiesTable row propertiesTag CloudTagalogTaglineTagsTags indicating styles and features of the theme.Tags listTags list navigationTags: Take overTanTargetTaxonomies associated with post type.Taxonomy names must be between 1 and 32 characters in length.Taxonomy:TemplateTemplate "%s" is already registered.Template "%s" is not registered.Template Part AreaTemplate Part AreasTemplate PartsTemplate archivesTemplate for %sTemplate is missing. Standalone themes need to have a %1$s or %2$s template file. <a href="%3$s">Child themes</a> need to have a %4$s header in the %5$s stylesheet.Template nameAll ArchivesTemplate nameAuthor ArchivesTemplate nameBlog HomeTemplate nameCategory ArchivesTemplate nameDate ArchivesTemplate nameFront PageTemplate nameIndexTemplate namePage: 404Template namePagesTemplate namePost Format: %sTemplate nameSearch ResultsTemplate nameSingle EntriesTemplate nameSingle PostsTemplate nameTag ArchivesTemplate nameTaxonomyTemplate names must be strings.Template names must contain a namespace prefix. Example: my-plugin//my-custom-templateTemplate names must not contain uppercase characters.Template part archivesTemplate part has been deleted or is unavailable: %sTemplate part updated.Template parts listTemplate parts list navigationTemplate parts to include in your templates.Template updated.TemplatesTemplates based on theme files can't be removed.Templates based on theme files can't have revisions.Templates listTemplates list navigationTemplates to include in your theme.Term ID ListTerm ID Taxonomy QueryTerm ID is shared between multiple taxonomiesTerm IDs.Term does not exist.Term meta cannot be added to terms that are shared between taxonomies.Terms do not support trashing. Set '%s' to delete.TextText and image generation with GPT and Dall-E.Text and image generation with Gemini and Imagen.Text colorText for the title attribute of the link element for this menu item.Text generation with Claude.Text to displayThaiThanks for confirming your erasure request.Thanks for confirming your export request.That audio file cannot be found. Check your <a href="%s">media library</a> and make sure it was not deleted.That email address is pending activation and is not available for new registration. If you made a previous attempt with this email address, please check your inbox for an activation email. If left unconfirmed, it will become available in a couple of days.That file cannot be found. Check your <a href="%s">media library</a> and make sure it was not deleted.That image cannot be found. Check your <a href="%s">media library</a> and make sure it was not deleted.That name is not allowed.That site is currently reserved but may be available in a couple days.That user does not exist.That username is already activated.That username is currently reserved but may be available in a couple of days.That video cannot be found. Check your <a href="%s">media library</a> and make sure it was not deleted.The "%1$s" option key has been renamed to "%2$s".The "%1$s" taxonomy "%2$s" property (%3$s) conflicts with an existing property on the REST API Posts Controller. Specify a custom "rest_base" when registering the taxonomy to avoid this error.The "%s" must be a callable function.The "%s" options group has been removed. Use another settings group.The "%s" theme is not a valid parent theme.The "get_value_callback" parameter must be a valid callback.The "type" schema keyword for %1$s can only be one of the built-in types: %2$l.The "type" schema keyword for %1$s can only contain the built-in types: %2$l.The "type" schema keyword for %s is required.The "uses_context" parameter must be an array.The $source_properties array contains invalid properties.The $source_properties must contain a "get_value_callback".The $source_properties must contain a "label".The %1$s filter must return an integer value greater than 0.The %1$s option is deprecated for the family of %2$s functions. Use the %3$s function instead.The %1$s option is deprecated for the family of %2$s functions. Use the %3$s option instead.The %1$s parameter must be an array. To pass arbitrary data to scripts, use the %2$s function instead.The %1$s, %2$s, and %3$s values can be edited to set the video track language and kind.The %s argument must be a string or a string array.The %s constant is no longer supported.The %s filter must return a non-negative number.The %s key must be a string without spaces.The %s parameter must not be empty.The %s property has an invalid stored value, and cannot be updated to null.The %s table is not installed. Please run the network database upgrade.The &#8220;slug&#8221; is the URL-friendly version of the name. It is usually all lowercase and contains only letters, numbers, and hyphens.The CSS must not contain "%s".The CSS must not end in "%s".The DB ID of the nav_menu_item that is this item's menu parent, if any, otherwise 0.The Edit Media screen is deprecated as of WordPress 6.3. Please use the Media Library instead.The Footer template defines a page area that typically contains site credits, social links, or any other combination of blocks.The GD image library is not installed.The GMT date the application password was created.The GMT date the application password was last used.The HTML parameter must be a string.The Header template defines a page area that typically contains a title, logo, and main navigation.The ID for the associated post of the attachment.The ID for the author of the post.The ID for the author of the revision.The ID for the author of the template.The ID for the autosave.The ID for the parent font family of the font face.The ID for the parent of the autosave.The ID for the parent of the comment.The ID for the parent of the global styles revision.The ID for the parent of the object.The ID for the parent of the post.The ID for the parent of the revision.The ID of the assigned menu.The ID of the associated post object.The ID of the featured media for the post.The ID of the page that should be displayed on the front pageThe ID of the page that should display the latest postsThe ID of the user object, if author was a user.The IDs of the child font faces in the font family.The IP address the application password was last used by.The Navigation Overlay template defines an overlay area that typically contains navigation links and can be toggled open and closed.The Open Graph image link of the %1$s or %2$s element from the URL.The PHP runtime version executing WordPress.The Press This plugin is required.The REST API can no longer be completely disabled, the %s filter can be used to restrict access to the API, instead.The REST API route definition for %1$s is missing the required %2$s argument. For REST API routes that are intended to be public, use %3$s as the permission callback.The REST route parameter must be a string.The SSL certificate for the host could not be verified.The Site Icon is what you see in browser tabs, bookmark bars, and within the WordPress mobile apps. It should be square and at least <code>%1$s by %2$s</code> pixels.The Site address you entered did not appear to be a valid URL. Please enter a valid URL.The URI of the theme's webpage, as found in the theme header.The URI of the theme's webpage, transformed for display.The URI of the theme's webpage.The URL of the resource for which to fetch oEmbed data.The URL to process.The URL to the admin areaThe URL to which this menu item points.The URL you entered seems to be an email address. Do you want to add the required mailto: prefix?The URL you entered seems to be an external link. Do you want to add the required http:// prefix?The URL-friendly name for the user.The WordPress address you entered did not appear to be a valid URL. Please enter a valid URL.The WordPress core version running on this site.The WordPress installation URL.The WordPress version.The WordPress.org username of the block author.The XFN relationship expressed in the link of this menu item.The ability %s was not found.The ability args should provide a valid `ability_class` that extends WP_Ability.The ability category properties must contain a `description` string.The ability category properties must contain a `label` string.The ability category properties should provide a valid `meta` array.The ability category slug cannot be empty.The ability meta should provide a valid `annotations` array.The ability meta should provide a valid `show_in_rest` boolean.The ability properties must contain a `category` string.The ability properties must contain a `description` string.The ability properties must contain a `label` string.The ability properties must contain a valid `execute_callback` function.The ability properties must provide a valid `permission_callback` function.The ability properties should provide a valid `input_schema` definition.The ability properties should provide a valid `meta` array.The ability properties should provide a valid `output_schema` definition.The amount to rotate the image clockwise in degrees. DEPRECATED: Use `modifiers` instead.The attachment MIME type.The attachment caption.The attachment description.The attributes of the inner block.The attributes used in the example.The authenticated application password can only be introspected for the current user.The average rating of blocks published by the same author.The backup of this post in your browser is different from the version below.The block icon.The block name, in namespace/block-name format.The block slug.The block template associated with the post type.The block title, in human readable format.The block types which can use this pattern.The calendar block is hidden because there are no published posts.The called constructor method for %1$s class in %2$s is <strong>deprecated</strong> since version %3$s! Use %4$s instead.The called constructor method for %1$s class is <strong>deprecated</strong> since version %2$s! Use %3$s instead.The categories for the font collection.The category description, in human readable format.The category label, in human readable format.The category name.The category this test is grouped in.The changes you made will be lost if you navigate away from this page.The comment cannot be deleted.The comment does not support trashing. Set '%s' to delete.The comment has already been trashed.The confirmation key has expired for this personal data request.The confirmation key is invalid for this personal data request.The confirmation key is missing from this personal data request.The connector registry instance must be set during the <code>init</code> action.The constant %1$s <strong>is deprecated</strong>. Use the boolean constant %2$s in %3$s to enable a subdomain configuration. Use %4$s to check whether a subdomain configuration is enabled.The content for the comment.The content for the post.The content of the %s element from the URL.The contents of the %s element from the URL.The context can only be read during directive processing.The context element "%s" is not supported.The context element cannot be a void element, found "%s".The context element must be a start tag.The cron event list could not be saved.The current image has no alternative text. The file name is: %sThe current user can assign terms in the %s taxonomy.The current user can change the author on this post.The current user can create terms in the %s taxonomy.The current user can post unfiltered HTML markup and JavaScript.The current user can publish this post.The current user can sticky this post.The database ID of the original object this menu item represents, for example the ID for posts or the term_id for categories.The database server could be connected to (which means your username and password is okay) but the %s database could not be selected.The database server vendor and version string reported by the driver.The date and time the preferences were updated.The date the comment was published, as GMT.The date the comment was published, in the site's timezone.The date the post was last modified, as GMT.The date the post was last modified, in the site's timezone.The date the post was published, as GMT.The date the post was published, in the site's timezone.The date the revision was last modified, as GMT.The date the revision was last modified, in the site's timezone.The date the revision was published, as GMT.The date the revision was published, in the site's timezone.The date the template was last modified, in the site's timezone.The date when the block was last updated, in human readable format.The date when the block was last updated.The description for the font collection.The description is not prominent by default; however, some themes may show it.The description of the menu location.The description of this menu item.The description will be displayed in the menu if the active theme supports it.The display name of the user.The duotone id "%1$s" is not registered in %2$s settingsThe eagerness value "%s" is forbidden for document-level speculation rules.The edit field automatically highlights code syntax. You can disable this in your <a href="%1$s" %2$s>user profile%3$s</a> to work in plain text mode.The element can only be read during directive processing.The email address entered did not appear to be a valid email address. Please enter a valid email address.The email address for the user.The email could not be sent. Possible reason: your host may have disabled the %s function.The email is correctThe excerpt for the post.The family of objects originally represented, such as "post_type" or "taxonomy".The favicon image link of the %s element from the URL.The feature "type" is not valid JSON Schema type.The file URL has been copied to your clipboardThe filesystem is currently unavailable for managing plugins.The first plugin requires the second plugin.%1$s requires %2$sThe following From address failed: The following formatting shortcuts are replaced when pressing Enter. Press Escape or the Undo button to undo.The following plugins must be activated first: %s.The following values do not describe a valid date: month %1$s, day %2$s.The following values do not describe a valid date: year %1$s, month %2$s, day %3$s.The font face does not belong to the specified font family with id of "%d".The font families for the font collection.The format for the post.The generated password. Only available after adding an application.The given object ID is not that of a menu item.The globally unique identifier for the post.The handle "%1$s" was enqueued with dependencies that are not registered: %2$s.The handler for the route is invalidThe handler for the route is invalid.The human-readable label for the style.The icon content (SVG markup).The icon for the post type.The icon label.The icon name.The id of a registered sidebarThe id of a templateThe image already has the requested size.The image cannot be rotated because the embedded meta data cannot be updated.The image was not edited. Edit the image before applying the changes.The initial values for attributes.The link text cannot be empty.The link you followed has expired.The list of inner blocks used in the example.The list of scopes where the variation is applicable. When not provided, it assumes all available scopes.The locale string for the user, such as en_US.The locations assigned to the menu.The login page will open in a new tab. After logging in you can close it and return to this page.The login username for the user.The maximum height of the embed frame in pixels.The maximum width of the embed frame in pixels.The menu ID should not be empty.The menu cannot be deleted.The menu name %s conflicts with another menu name. Please try another.The menu provided is not a valid menu.The minimum PHP version required for the theme to work.The minimum WordPress version required for the theme to work.The name for the font collection.The name is how it appears on your site.The name of the application password.The name of the inner block.The name of the menu location.The name of the test being run.The name of the theme.The namespace can only be omitted during directive processing.The namespace is required when state data is passed.The namespace should be a non-empty string.The network currently allows both site and user registrations.The network currently allows site registrations.The network currently allows user registrations.The network currently disallows registrations.The next group of formatting shortcuts are applied as you type or when you insert them around plain text in the same paragraph. Press Escape or the Undo button to undo.The nickname for the user.The number of blocks published by the same author.The number of ratings.The number sites that have activated this block.The oEmbed format to use.The offset number requested is larger than or equal to the number of available revisions.The order of the post in relation to other posts.The page number requested is larger than the number of pages available.The parent term ID.The parent theme is missing. Please install the "%s" parent theme.The password cannot be a space or all spaces.The password for the parent post of the comment (if the post is password protected).The password for the post if it is password protected.The pattern ID.The pattern category slugs.The pattern content.The pattern detailed description.The pattern keywords.The pattern name.The pattern title, in human readable format.The pattern viewport width for inserter preview.The pattern's category slugs.The pattern's keywords.The pingback has already been registered.The plugin activation status.The plugin author.The plugin description formatted for display.The plugin description.The plugin file.The plugin has no required plugins.The plugin is not installed.The plugin name.The plugin version number.The plugin's text domain.The plugin's website address.The post ID must be greater than 0.The post cannot be deleted.The post does not support trashing. Set '%s' to delete.The post has already been deleted.The post status %1$s is not registered, so it may not be reliable to check the capability %2$s against a post with that status.The post type %1$s is not registered, so it may not be reliable to check the capability %2$s against a post of that type.The post type may not be changed.The post types that support thumbnails or true if all post types are supported.The preferred width of the viewport when previewing a pattern, in pixels.The previous set of changes has already been published. Please try saving your current set of changes again.The provided instance is invalid. Must contain raw OR encoded and hash.The provided instance is malformed.The provided password is an invalid application password.The provided widget type (id_base) cannot be updated.The provider "%s" is not registered in the AI client registry.The query argument must be an array or a tag name.The query argument of %s must have a placeholder.The query does not contain the correct number of placeholders (%1$d) for the number of arguments passed (%2$d).The query only expected one placeholder, but an array of multiple placeholders was sent.The raw plugin description.The rendered block.The requested route does not support batch requests.The requested theme does not exist.The requested user does not exist.The requested widget is invalid.The result of the ability execution.The revision does not belong to the specified parent with id of "%d"The role %s does not exist.The roles assigned to the user.The script handle "%1$s" has one or more of its script module dependencies ("%2$s") which are invalid.The script module with the ID "%1$s" was enqueued with dependencies that are not registered: %2$s.The script with the handle "%1$s" was enqueued with dependencies that are not registered: %2$s.The script with the handle "%1$s" was enqueued with script module dependencies ("%2$s") that are not registered: %3$s.The search results will be updated as you type.The server cannot process the image. This can happen if the server is busy or does not have enough resources to complete the task. Uploading a smaller image may help. Suggested maximum size is 2560 pixels.The sidebar the widget belongs to.The sidebar to return widgets for.The singular label used to describe this type of menu item.The site %s is yours.The site administrator email address.The site administrator has been notified and will fulfill your request as soon as possible.The site administrator has been notified. You will receive a link to download your export via email when they fulfill your request.The site administrator has been notified. You will receive an email confirmation when they erase your data.The site appears to be already initialized.The site appears to be already uninitialized.The site character encoding.The site home URL.The site is already active.The site language locale code.The site tagline.The site title.The site you have requested is not installed properly. Please contact the system administrator.The site you were looking for, %s, does not exist, but you can create it now!The site you were looking for, %s, does not exist.The site's runtime environment classification (can be one of these: production, staging, development, local).The slug &#8220;%s&#8221; is already in use by another term.The slug of the template to get the fallback forThe source URL and the target URL cannot both point to the same resource.The source URL does not contain a link to the target URL, and so cannot be used as a source.The source URL does not exist.The specified manifest file does not exist.The specified namespace could not be found.The specified target URL cannot be used as a target. It either does not exist, or it is not a pingback-enabled resource.The specified target URL does not exist.The star rating of the block.The status of the test.The style with the handle "%1$s" was enqueued with dependencies that are not registered: %2$s.The tag cloud will not be displayed since there are no taxonomies that support the tag cloud widget.The target attribute of the link element for this menu item.The template cannot be deleted.The template has already been deleted.The template prefix for the created template. This is used to extract the main template type, e.g. in `taxonomy-books` extracts the `taxonomy`The template_lock associated with the post type, or false if none.The term cannot be deleted.The term name cannot be empty.The terms assigned to the object in the %s taxonomy.The terms assigned to the post in the %s taxonomy.The theme author's name, as found in the theme header.The theme author.The theme defines itself as its parent theme. Please check the %s header.The theme description, as found in the theme header.The theme description, transformed for display.The theme directory "%s" does not exist.The theme file to use to display the post.The theme identifierThe theme name, as found in the theme header.The theme name, transformed for display.The theme tags, as found in the theme header.The theme tags, transformed for display.The theme's current version.The theme's screenshot URL.The theme's stylesheet. This uniquely identifies the theme.The theme's template. If this is a child theme, this refers to the parent theme, otherwise this is the same as the theme's stylesheet.The theme's text domain.The timezone you have entered is not valid. Please select a valid timezone.The title for the object.The title for the post type.The title for the post.The title for the status.The title for the taxonomy.The title is required when using a custom menu item type.The type of object originally represented, such as "category", "post", or "attachment".The type of the widget. Corresponds to ID in widget-types endpoint.The unique and machine-readable name.The unique identifier for the Navigation Menu.The unique identifier for the application password.The uri for the theme's stylesheet directory.The uri for the theme's template directory. If this is a child theme, this refers to the parent theme, otherwise this is the same as the theme's stylesheet directory.The url is required when using a custom menu item type.The user ID.The user cannot be deleted.The user is already active.The user_pass field is required when creating a new user. The user will need to reset their password before logging in.The value "%s" is not a valid ID for a speculation rule.The value "%s" is not a valid eagerness for a speculation rule.The value "%s" is not a valid source for a speculation rule.The value "%s" is not a valid speculation rules mode.The value for "%1$s" must be an array for the "%2$s" script.The visibility settings for the post type.The visibility settings for the taxonomy.The web browser on your device cannot be used to upload files. You may be able to use the <a href="%s">native app for your device</a> instead.The web server cannot generate responsive image sizes for this image. Convert it to JPEG or PNG before uploading.The website of the theme author, as found in the theme header.The website of the theme author, transformed for display.The website of the theme author.The widget type id.ThemeTheme DetailsTheme file exists.Theme identifier for the template.Theme not found.Theme starter content123 Main StreetTheme starter contentA homepage sectionTheme starter contentAboutTheme starter contentAbout This SiteTheme starter contentAddressTheme starter contentArchivesTheme starter contentBlogTheme starter contentCalendarTheme starter contentCategoriesTheme starter contentContactTheme starter contentEmailTheme starter contentFacebookTheme starter contentFind UsTheme starter contentFoursquareTheme starter contentGitHubTheme starter contentHomeTheme starter contentHoursTheme starter contentInstagramTheme starter contentLinkedInTheme starter contentMetaTheme starter contentMonday&ndash;Friday: 9:00AM&ndash;5:00PMTheme starter contentNew York, NY 10001Theme starter contentNewsTheme starter contentPinterestTheme starter contentRecent CommentsTheme starter contentRecent PostsTheme starter contentSaturday &amp; Sunday: 11:00AM&ndash;3:00PMTheme starter contentSearchTheme starter contentThis is a page with some basic contact information, such as an address and phone number. You might also try a plugin to add a contact form.Theme starter contentThis is an example of a homepage section. Homepage sections can be any page other than the homepage itself, including the page that shows your latest blog posts.Theme starter contentThis may be a good place to introduce yourself and your site or include some credits.Theme starter contentTwitterTheme starter contentWelcome to your site! This is your homepage, which is what most visitors will see when they come to your site for the first time.Theme starter contentYelpTheme starter contentYou might be an artist who would like to introduce yourself and your work here or maybe you are a business with a mission to describe.Theme starter contentYouTubeTheme support for %1$s should be registered before the %2$s hook.Theme without %sThemesThere are no HTTP transports available which can complete the requested request.There are no associated subtitles.There are no options for this widget.There does not seem to be any new mail.There doesn't seem to be a %s file. It is needed before the installation can continue.There has been a critical error on this website, putting it in recovery mode. Please check the Themes and Plugins screens for more details. If you just installed or updated a theme or plugin, check the relevant page for that first.There has been a critical error on this website.There has been a critical error on this website. Please check your site admin email inbox for instructions. If you continue to have problems, please try the <a href="%s">support forums</a>.There has been a critical error on this website. Please reach out to your site administrator, and inform them of this error for further assistance.There has been an error cropping your image.There is %d error which must be fixed before you can save.There are %d errors which must be fixed before you can save.There is a more recent autosave of your changes than the one you are previewing. <a href="%s">Restore the autosave</a>There is a new version of %s available, but it does not work with your version of PHP.There is a new version of %s available, but it does not work with your version of WordPress.There is a new version of %s available, but it does not work with your versions of WordPress and PHP.There is a revision of this post that is more recent.There is already a ping from that URL for this post.There is no autosave revision for this post.There is no autosave revision for this template.There is no excerpt because this is a protected post.There was a configuration error. Please contact the server administrator.There was a problem, please correct the form below and try again.There was an authentication problem. Please reload and try again.There&#8217;s no content to show here yet.These plugins cannot be activated because their requirements are invalid.This XML Sitemap is generated by WordPress to make your content more visible for search engines.This action has been disabled by the administrator.This address is used for admin purposes, like new user notification.This argument has changed to an array to match the behavior of the other cron functions.This block is automatically inserted near any occurrence of the block types used as keys of this map, into a relative position given by the corresponding value.This content is password protected.This content is password-protected. To view it, please enter the password below.This content was deleted by the author.This either means that the username and password information in your %1$s file is incorrect or that contact with the database server at %2$s could not be established. This could mean your host&#8217;s database server is down.This email may be different from your personal email address.This feature requires inline frames. You have iframes disabled or your browser does not support them.This file cannot be processed by the web server.This file is empty. Please try another.This file is not an image. Please try another.This file is only loaded for backward compatibility with SimplePie 1.2.x. Please consider switching to a recent SimplePie version.This file is too big. Files must be less than %s KB in size.This file no longer needs to be included.This form is not live-previewable.This function should not be called before the theme directory is registered.This image cannot be displayed in a web browser. For best results convert it to JPEG before uploading.This is larger than the maximum size. Please try another.This is the short link.This link is not live-previewable.This means that the contact with the database server at %s was lost. This could mean your host&#8217;s database server is down.This notice was triggered by the %s handle.This page is blank because the template is empty. You can reset or customize it in the Site Editor.This panel is used for managing navigation menus for content you have already published on your site. You can create menus and add items for existing content such as pages, posts, categories, tags, formats, or custom links.This password reset request originated from the IP address %s.This personal data request has expired.This post is password protected. Enter the password to view comments.This resource is provided by your web host, and is specific to your site. For more information, <a href="%s" target="_blank">see the official WordPress documentation</a>.This site does not support post thumbnails on attachments with MIME type %s.This site has been archived or suspended.This site has not been activated yet. If you are having problems activating your site, please contact %s.This site is no longer available.This taxonomy is not hierarchical.This theme does not support video headers on this page. Navigate to the front page or another page that supports video headers.This theme does not work with your version of PHP.This theme does not work with your version of WordPress.This theme does not work with your versions of WordPress and PHP.This theme doesn't support Customizer.This theme failed to load properly and was paused within the admin backend.This type of file cannot be edited.This username is invalid because it uses illegal characters. Please enter a valid username.This video file is too large to use as a header video. Try a shorter video or optimize the compression settings and re-upload a file that is less than 8MB. Or, upload your video to YouTube and link it with the option below.This widget may contain code that may work better in the &#8220;Custom HTML&#8221; widget. How about trying that widget instead?This widget may have contained code that may work better in the &#8220;Custom HTML&#8221; widget. If you have not yet, how about trying that widget instead?ThuThumbnailThumbnail HeightThumbnail WidthThursdayThursday initialTTimeTime FormatTime SliderTime ZoneTime to add some links! Click &#8220;%s&#8221; to start putting pages, categories, and custom links in your menu. Add as many things as you would like.TinyMCEBlocksTinyMCEFormatsTinyMCEHeadingsTinyMCEInsert templateTinyMCETemplatesTinyMCE menuEditTinyMCE menuFileTinyMCE menuFormatTinyMCE menuInsertTinyMCE menuTableTinyMCE menuToolsTinyMCE menuViewTitleTitle AttributeTitle for the global styles variation, as it exists in the database.Title for the object, as it exists in the database.Title for the post, as it exists in the database.Title for the template, as it exists in the database.Title for the widgetTitle of a Navigation menuNavigationTitle of block type.Title of template.Title of the global styles variation.Title:To activate your site, please click the following link:

%1$s

After you activate, you will receive *another email* with your login.

After you activate, you can visit your site here:

%2$sTo activate your user, please click the following link:

%s

After you activate, you will receive *another email* with your login.To change or disable registration go to your <a href="%s">Options page</a>.To move away from this area, press the Esc key followed by the Tab key.To move focus to other buttons use Tab or the arrow keys. To return focus to the editor press Escape or use one of the buttons.To reset your password, visit the following address:To set your password, visit the following address:TodayToggle Editor Text DirectionToken Map tokens and substitutions must all be shorter than %1$d bytes.Too many bookmarks: cannot create any more.Too many calls to seek() - this can lead to performance issues.Too many redirects.ToolbarToolbar ToggleToolsTopTop LeftTop RightTrackbackTrackback excerpt: Tracks (subtitles, captions, descriptions, chapters, or metadata)Translation UpdatesTranslation loading for the %1$s domain was triggered too early. This is usually an indicator for some code in the plugin or theme running too early. Translations should be loaded at the %2$s action or later.Trash <span class="count">(%s)</span>Trash <span class="count">(%s)</span>Trash it: %sTueTuesdayTuesday initialTTurkishTwice DailyTypeType / to choose a blockType attribution for the term.Type of post.Type of template.Type of the comment.Types associated with the taxonomy.URLURL for the comment author.URL not found. Response returned a non-200 status code for this URL.URL of the term.URL of the user.URL to a preview image of the font face.URL to a preview image of the font family.URL to the %s audio source fileURL to the %s video source fileURL to the comment.URL to the edited image file.URL to the media fileURL to the object.URL to the original attachment file.URL to the post.URL-encoded form data from the widget admin form. Used to update a widget that does not support instance. Write only.URL: %sUTCUkrainianUnable to connect to the filesystem. Please confirm your credentials.Unable to convert Classic Menu to blocks.Unable to create directory %s. Is its parent directory writable by the server?Unable to crop this image.Unable to determine what plugin was installed.Unable to edit this image.Unable to flip this image.Unable to get meta information for file.Unable to locate WordPress content directory (%s).Unable to open export file (archive) for writing.Unable to pass %s if not using multisite.Unable to preview media due to an unknown error.Unable to read the "%1$s" key with value "%2$s" for stylesheet "%3$s".Unable to retrieve body from response at this URL.Unable to retrieve the error message from the database serverUnable to rotate this image.Unable to save due to %s invalid setting.Unable to save due to %s invalid settings.Unable to send personal data export confirmation email.Unable to set inline script data.Unable to submit this form, please try again.Unable to trash changes.UnapprovedUnauthorized to modify setting due to capability.Unauthorized. You may remove the %s param to preview as frontend.UncategorizedUncaught "%s" thrown:Uncaught error executing a derived state callback with path "%1$s" and namespace "%2$s".Unchanged:Under %sUnderlineUndoUnencoded instance settings, if supported.Unexpected response from the server. The file may have been uploaded successfully. Check in the Media Library or reload the page.Unique identifier for the ability category.Unique identifier for the ability.Unique identifier for the attachment.Unique identifier for the comment.Unique identifier for the font collection.Unique identifier for the font face.Unique identifier for the global styles revision.Unique identifier for the object.Unique identifier for the post.Unique identifier for the revision.Unique identifier for the term.Unique identifier for the user.Unique identifier for the widget.Unique name identifying the block type.Unique name identifying the sidebar.Unique name identifying the style.Unique registered name for the block.Unique slug identifying the template.Unique slug identifying the widget type.Unknown FeedUnknown authorUnknown bookmark name.Unknown email address. Check again or try your username.Unknown encoding: UnmuteUnrecognized background setting.Unrecognized key(s) in the %1$s param: %2$s. Supported keys: %3$sUnregistering a built-in post type is not allowedUnregistering a built-in taxonomy is not allowed.Unsupported hashing algorithm: %1$s. Supported algorithms are: %2$sUnsupported value type (%s).UntitledUntitled post %dUpdateUpdate CategoryUpdate Link CategoryUpdate PHPUpdate Pattern CategoryUpdate TagUpdate anyway, even though it might break your site?Update audio playlistUpdate galleryUpdate nowUpdate video playlistUpdatingUpdating comment failed.Updating comment status failed.Upload Limit ExceededUpload failed.Upload filesUpload imagesUpload stopped.Upload your video in %1$s format and minimize its file size for best results. Your theme recommends a height of %2$s pixels.Upload your video in %1$s format and minimize its file size for best results. Your theme recommends a width of %2$s pixels.Upload your video in %1$s format and minimize its file size for best results. Your theme recommends dimensions of %2$s pixels.Uploaded by:Uploaded on:Uploaded to this Navigation MenuUploaded to this pageUploaded to this postUploaded to this templateUploaded to this template partUploaded to:Uploader: Drop files here - or - Select FilesorUploadingUsage of the title attribute on the login logo is not recommended for accessibility reasons. Use the link text instead.Usage of user levels is deprecated. Use capabilities instead.Use %s instead if you do not want the value echoed.Use %s instead.Use Left/Right Arrow keys to advance one second, Up/Down arrows to advance ten seconds.Use Site EditorUse Up/Down Arrow keys to increase or decrease volume.Use as a `pre_render_block` filter is deprecated. Use with `render_block_data` instead.Use commas instead of %s to separate excluded terms.Use the %s filter instead.Use the Custom HTML widget to add arbitrary HTML code to your widget areas.Used as a fallback template for all pages when a more specific template is not defined.Used as:UserUser AgentUser Dashboard: %sUser DescriptionUser Display NameUser EmailUser First NameUser IDUser Last NameUser Login NameUser Nice NameUser NicknameUser Registration DateUser RequestUser RequestsUser URLUser URL may not be longer than 100 characters.User action confirmed.User agent for the comment author.User cannot be added to this site.User error triggered:User has blocked requests through HTTP to the URL: %s.User queries should not be run before the %s hook.User registration has been disabled.User roleAdministratorUser roleAuthorUser roleContributorUser roleEditorUser roleSubscriberUser&#8217;s Session Tokens data.User&#8217;s comment data.User&#8217;s location data used for the Community Events in the WordPress Events and News dashboard widget.User&#8217;s media data.User&#8217;s profile data.UsernameUsername is not editable.Username may not be longer than 60 characters.Username must be at least 4 characters.Username or Email AddressUsername:Username: %sUsernames can only contain lowercase letters (a-z) and numbers.UsersUsers do not support trashing. Set '%s' to delete.Using simplified address parser is not recommended. Install the PHP IMAP extension for full RFC822 parsing.ValueValues for the input array must be either objects or arrays.VersionVersion of block API.Version of the content block format used by the post.Version of the content block format used by the template.Version of the theme.json schema used for the typography settings.Vertical position from the top to begin the crop as a percentage of the image height.Vertical spaceVideoVideo <span class="count">(%s)</span>Video <span class="count">(%s)</span>Video PlayerVideo WidgetVideo Widget (%d)Video Widget (%d)Video detailsVideo is paused.Video is playing.Video titleVideo title&hellip;VietnameseViewView Attachment PageView CategoryView ChangesetView Media FileView Navigation MenuView PageView PagesView PatternView Pattern CategoryView PatternsView PostView PostsView TagView TemplateView Template PartView UserView attachment pageView media fileView postVisibility:VisibleVisit %s&#8217;s websiteVisit SiteVisual aidsVolume SliderWait a little longer. Sometimes delivery of email can be delayed by processes outside of our control.Warning: %1$s expects parameter %2$s (%3$s) to be a %4$s, %5$s given.Warning: the link has been inserted but may have errors. Please test it.Webfont font family must be a non-empty string.Webfont font weight must be a properly formatted string or integer.Webfont src must be a non-empty string or an array of strings.WebsiteWebsite: %1$s (IP address: %2$s, %3$s)WedWednesdayWednesday initialWWelcome back, %s. By filling out the form below, you can <strong>add another site to your account</strong>. There is no limit to the number of sites you can have, so create to your heart&#8217;s content, but write responsibly!WelshWhat do I do now?What to show on the front pageWhen checking for the %s capability, you must always check it against a specific comment.When checking for the %s capability, you must always check it against a specific page.When checking for the %s capability, you must always check it against a specific post.When checking for the %s capability, you must always check it against a specific term.When checking for the %s capability, you must always check it against a specific user.When in reorder mode, additional controls to reorder menu items will be available in the items list above.When in reorder mode, additional controls to reorder widgets will be available in the widgets list above.When registering a "variadic" theme feature, the "type" must be an "array".When registering a default meta value the data must match the type provided.When registering an "array" feature, the feature's schema must include the "items" keyword.When registering an "array" meta type to show in the REST API, you must specify the schema for each array item in "show_in_rest.schema.items".When registering an "array" or "object" feature to show in the REST API, the feature's schema must also be defined.When registering an "array" setting to show in the REST API, you must specify the schema for each array item in "show_in_rest.schema.items".When registering an "object" feature, the feature's schema must include the "properties" keyword.When starting a new paragraph with one of these formatting shortcuts followed by a space, the formatting will be applied automatically. Press Backspace or Escape to undo.When the %1$s arg is provided, the "%2$s" script must either be printed in the footer (%3$s set to true) or use a deferred loading %4$s (%5$s) so that the import map is printed before the script is evaluated.When using a keyboard to navigate:When using the %1$s constant, make sure to set these globals to an array: %2$s.Where the pattern comes from e.g. coreWhere the template originally comes from e.g. 'theme'Where the template part is intended for use (header, footer, etc.)Whether a taxonomy is intended for use publicly either via the admin interface or by front-end users.Whether a template is a custom template.Whether a theme uses block-based template parts.Whether a theme uses block-based templates.Whether items must be assigned all or any of the specified terms.Whether or not comments are open on the post.Whether or not the post can be pinged.Whether or not the post should be treated as sticky.Whether or not the post type can be viewed.Whether or not the post type should have children.Whether or not the taxonomy should have children.Whether or not the term cloud should be displayed.Whether posts and comments RSS feed links are added to head.Whether posts of this status may have floating published dates.Whether posts of this status should be shown in the front end of the site.Whether posts with this status should be private.Whether posts with this status should be protected.Whether posts with this status should be publicly-queryable.Whether the content is protected with a password.Whether the excerpt is protected with a password.Whether the menu item represents an object that no longer exists.Whether the plugin can only be activated network-wide.Whether the taxonomy is publicly queryable.Whether the theme can manage the document title tag.Whether the theme disables custom colors.Whether the theme disables custom font sizes.Whether the theme disables custom gradients.Whether the theme disables generated layout styles.Whether the theme enables Selective Refresh for Widgets being managed with the Customizer.Whether the theme is a block-based theme.Whether the theme supports responsive embedded content.Whether the widget supports multiple instancesWhether theme opts in to default WordPress block styles for viewing.Whether theme opts in to the dark editor style UI.Whether theme opts in to the editor styles CSS wrapper.Whether theme opts in to wide alignment CSS class.Whether to allow automatic creation of taxonomy columns on associated post-types table.Whether to automatically add top level pages to this menu.Whether to bypass Trash and force deletion.Whether to flip in the horizontal direction.Whether to flip in the vertical direction.Whether to force removal of the widget, or move it to the inactive sidebar.Whether to generate a default UI for managing this post type.Whether to generate a default UI for managing this taxonomy.Whether to hide terms not assigned to any posts.Whether to ignore sticky posts or not.Whether to include child terms in the terms limiting the result set.Whether to include posts in the edit listing for their post type.Whether to make the post type available for selection in navigation menus.Whether to make the taxonomy available for selection in navigation menus.Whether to perform an oEmbed discovery request for unsanctioned providers.Whether to show the taxonomy in the quick/bulk edit panel.While previewing a new theme, you can continue to tailor things like widgets and menus, and explore theme-specific options.WhiteWhy is this important?Widget moved downWidget moved upWidget type (id_base) is required.Widget type does not support raw instances.WidgetsWidgets are independent sections of content that can be placed into widgetized areas provided by your theme (commonly called sidebars).Widgets need to be registered using %s, before they can be displayed.WidthWidth of the crop as a percentage of the image width.Word count type. Do not translate!wordsWordPress &rsaquo; ErrorWordPress &rsaquo; SuccessWordPress Address (URL)WordPress CommentsWordPress EmbedWordPress MediaWordPress UserWordPress database error:WordPress database error: Could not perform query because it contains invalid data.WordPress database error: Processing the value for the following field failed: %s. The supplied value may be too long or contains invalid data.WordPress database error: Processing the values for the following fields failed: %s. The supplied values may be too long or contain invalid data.WordPress locale code.WordPress version %sWordPress.orgWordPress.org plugin directory slug.WordPress.org themesWords: %sXML SitemapXML-RPC services are disabled on this site.Y/m/dYearYellowYesYiddishYou appear to have already installed WordPress. To reinstall please clear your old database tables first.You are about to permanently delete these items from your site.
This action cannot be undone.
 'Cancel' to stop, 'OK' to delete.You are about to permanently delete this item from your site.
This action cannot be undone.
 'Cancel' to stop, 'OK' to delete.You are about to trash these items.
  'Cancel' to stop, 'OK' to delete.You are attempting to log out of %sYou are browsing %sYou are currently browsing the %1$s blog archives for %2$s.You are currently browsing the %1$s blog archives for the day %2$s.You are currently browsing the %1$s blog archives for the year %2$s.You are currently browsing the %s blog archives.You are currently browsing the archives for the %s category.You are customizing %sYou are logged in already. No need to register again!You are not currently logged in.You are now logged out.You are posting comments too quickly. Slow down.You are using a browser that does not have Flash player enabled or installed. Please turn on your Flash player plugin or download the latest version from https://get.adobe.com/flashplayer/You can choose what&#8217;s displayed on the homepage of your site. It can be posts in reverse chronological order (classic blog), or a fixed/static page. To set a static homepage, you first need to create two Pages. One will become the homepage, and the other will be where your posts are displayed.You can create a %s file through a web interface, but this doesn't work for all server setups. The safest way is to manually create the file.You can navigate to other pages on your site while using the Customizer to view and edit the widgets displayed on those pages.You can see all comments on this post here:You can see all notes on this post here:You can see all pingbacks on this post here:You can see all trackbacks on this post here:You cannot use that email address to signup. There are problems with them blocking some emails from WordPress. Please use another email provider.You have attempted to queue too many files.You have been added to this site. Please visit the <a href="%1$s">homepage</a> or <a href="%2$s">log in</a> using your username and password.You have logged in successfully.You have searched the %1$s blog archives for <strong>&#8216;%2$s&#8217;</strong>. If you are unable to find anything in these search results, you can try one of these links.You have used your space quota. Please delete files before uploading.You may only upload 1 file.You must be <a href="%s">logged in</a> to post a comment.You must first <a href="%s">log in</a>, and then you can create a new site.You must provide at least one recipient email address.You must supply a future date to schedule.You need a higher level of permission.You need to define a search term to order by relevance.You need to define an include parameter to order by include.You need to pass an array of post formats.You need to pass an array of types.You should specify an action to be verified by using the first parameter.You will not be able to install new themes from here yet since your install requires SFTP credentials. For now, please <a href="%s">add themes in the admin</a>.You&#8217;ll create a menu, assign it a location, and add menu items like links to pages and categories. If your theme has multiple menu areas, you might need to create more than one.Your %1$s file uses a dynamic value (%2$s) for the path at %3$s. However, the value at %3$s is also a dynamic value (pointing to %4$s) and pointing to another dynamic value is not supported. Please update %3$s to point directly to %4$s.Your PHP installation appears to be missing the MySQL extension which is required by WordPress.Your account has been activated. You may now <a href="%1$s">log in</a> to the site using your chosen username of &#8220;%2$s&#8221;. Please check your email inbox at %3$s for your password and login instructions. If you do not receive an email, please check your junk or spam folder. If you still do not receive an email within an hour, you can <a href="%4$s">reset your password</a>.Your account is now activated. <a href="%1$s">Log in</a> or go back to the <a href="%2$s">homepage</a>.Your account is now activated. <a href="%1$s">View your site</a> or <a href="%2$s">Log in</a>Your account is now active!Your address will be %s.Your blogrollYour browser cannot upload filesYour browser does not support direct access to the clipboard. Please use keyboard shortcuts or your browser&#8217;s edit menu instead.Your comment is awaiting moderation.Your comment is awaiting moderation. This is a preview; your comment will be visible after it has been approved.Your email address has not been updated yet. Please check your inbox at %s for a confirmation email.Your email address will not be published.Your homepage displaysYour latest postsYour object cache implementation does not support flushing individual groups.Your object cache implementation does not support flushing the in-memory runtime cache.Your password has been reset.Your registration email is sent to this address. (Double-check your email address before continuing.)Your session has expired. Please log in to continue where you left off.Your site at %1$s is active. You may now log in to your site using your chosen username of &#8220;%2$s&#8221;. Please check your email inbox at %3$s for your password and login instructions. If you do not receive an email, please check your junk or spam folder. If you still do not receive an email within an hour, you can <a href="%4$s">reset your password</a>.Your site&#8217;s most recent Posts.Your site&#8217;s most recent comments.Your theme can display menus in %s location.Your theme can display menus in %s locations.Your theme can display menus in %s location. Select which menu you would like to use.Your theme can display menus in %s locations. Select which menu appears in each location.Your theme can display menus in one location.Your theme can display menus in one location. Select which menu you would like to use.Your theme has %s other widget area, but this particular page does not display it.Your theme has %s other widget areas, but this particular page does not display them.Your theme has %s widget area, but this particular page does not display it.Your theme has %s widget areas, but this particular page does not display them.Your theme has 1 other widget area, but this particular page does not display it.Your theme has 1 widget area, but this particular page does not display it.Your timezone is set to %1$s (%2$s), currently %3$s (Coordinated Universal Time %4$s).Your timezone is set to %1$s (Coordinated Universal Time %2$s).Your version of PHP is affected by a bug that may result in corrupted messages. To fix it, switch to sending using SMTP, disable the %1$s option in your %2$s, or switch to MacOS or Linux, or upgrade your PHP version.Zip Export not supported.[%1$s] Action Confirmed: %2$s[%1$s] Comment: "%2$s"[%1$s] Confirm Action: %2$s[%1$s] Note: "%2$s"[%1$s] Pingback: "%2$s"[%1$s] Please moderate: "%2$s"[%1$s] Trackback: "%2$s"[%s] Admin Email Changed[%s] Email Change Request[%s] Email Changed[%s] Erasure Request Fulfilled[%s] Login Details[%s] Network Admin Email Change Request[%s] Network Admin Email Changed[%s] New Site Created[%s] New User Registration[%s] Password Changed[%s] Password Reset[%s] Your Site is Experiencing a Technical Issue[block rendering halted for pattern "%s"][block rendering halted][deleted]`boolean` type for second argument `$settings` is deprecated. Use `array()` instead.a daya minutea montha seconda yearadd new from admin barLinkadd new from admin barMediaadd new from admin barPageadd new from admin barPostadd new from admin barSiteadd new from admin barUseradmin bar menu group labelNewadmin color schemeBlueadmin color schemeCoffeeadmin color schemeDefaultadmin color schemeEctoplasmadmin color schemeFreshadmin color schemeLightadmin color schemeMidnightadmin color schemeOceanadmin color schemeSunriseaman hourapostrophe&#8217;archive title%1$s %2$sauthor archive title prefixAuthor:auto preloadAutoblock bindings sourcePattern Overridesblock bindings sourcePost Datablock bindings sourcePost Metablock bindings sourceTerm Datablock categoryDesignblock categoryEmbedsblock categoryMediablock categoryPatternsblock categoryTextblock categoryThemeblock categoryWidgetsblock descriptionA calendar of your site’s posts.block descriptionA cloud of popular keywords, each sized by how often it appears.block descriptionA collection of blocks that allow visitors to get around your site.block descriptionA customizable button to close overlays.block descriptionA single column within a columns block.block descriptionAdd a block that displays content pulled from other sites, like Twitter or YouTube.block descriptionAdd a link to a downloadable file.block descriptionAdd a page, link, or another item to your navigation.block descriptionAdd a submenu to your navigation.block descriptionAdd a user’s avatar.block descriptionAdd an image or video with a text overlay.block descriptionAdd custom HTML code and preview it as you edit.block descriptionAdd text that respects your spacing and tabs, and also allows styling.block descriptionAdd white space between blocks and customize its height.block descriptionAn advanced block that allows displaying post comments using different visual configurations.block descriptionAn advanced block that allows displaying post types based on different query parameters and visual configurations.block descriptionAn advanced block that allows displaying taxonomy terms based on different query parameters and visual configurations.block descriptionAn individual item within a list.block descriptionAn organized collection of items displayed in a specific order.block descriptionContains the block elements used to display a comment, like the title, date, author, avatar and more.block descriptionContains the block elements used to render a post, like the title, date, featured image, content or excerpt, and more.block descriptionContains the block elements used to render a taxonomy term, like the name, description, and more.block descriptionContains the block elements used to render content when no query results are found.block descriptionContains the hidden or revealed content beneath the heading.block descriptionContent before this block will be shown in the excerpt on your archives page.block descriptionCreate a break between ideas or sections with a horizontal separator.block descriptionCreate a link that always points to the homepage of the site. Usually not necessary if there is already a site title link present in the header.block descriptionCreate structured content in rows and columns to display information.block descriptionDescribe in a few words what this site is about. This is important for search results, sharing on social media, and gives overall clarity to visitors.block descriptionDisplay a breadcrumb trail showing the path to the current page.block descriptionDisplay a custom date.block descriptionDisplay a date archive of your posts.block descriptionDisplay a legacy widget.block descriptionDisplay a list of all pages.block descriptionDisplay a list of all terms of a given taxonomy.block descriptionDisplay a list of your most recent comments.block descriptionDisplay a list of your most recent posts.block descriptionDisplay a post's comments count.block descriptionDisplay a post's comments form.block descriptionDisplay a post's featured image.block descriptionDisplay an icon linking to a social profile or site.block descriptionDisplay an image to represent this site. Update this block and the changes apply everywhere.block descriptionDisplay code snippets that respect your spacing and tabs.block descriptionDisplay content in multiple columns, with blocks added to each column.block descriptionDisplay entries from any RSS or Atom feed.block descriptionDisplay footnotes added to the page.block descriptionDisplay icons linking to your social profiles or sites.block descriptionDisplay mathematical notation using LaTeX.block descriptionDisplay multiple images in a rich gallery.block descriptionDisplay the description of categories, tags and custom taxonomies when viewing an archive.block descriptionDisplay the excerpt.block descriptionDisplay the query title.block descriptionDisplay the total number of results in a query.block descriptionDisplays a foldable layout that groups content in collapsible sections.block descriptionDisplays a heading that toggles the accordion panel.block descriptionDisplays a link to edit the comment in the WordPress Dashboard. This link is only visible to users with the edit comment capability.block descriptionDisplays a link to reply to a comment.block descriptionDisplays a list of page numbers for comments pagination.block descriptionDisplays a list of page numbers for pagination.block descriptionDisplays a page inside a list of all pages.block descriptionDisplays a paginated navigation to next/previous set of comments, when applicable.block descriptionDisplays a paginated navigation to next/previous set of posts, when applicable.block descriptionDisplays a title with the number of comments.block descriptionDisplays the contents of a comment.block descriptionDisplays the contents of a post or page.block descriptionDisplays the date on which the comment was posted.block descriptionDisplays the link of a post, page, or any other content-type.block descriptionDisplays the link to the current post comments.block descriptionDisplays the name of a taxonomy term.block descriptionDisplays the name of the author of the comment.block descriptionDisplays the name of this site. Update the block, and the changes apply everywhere it’s used. This will also appear in the browser title bar and in search results.block descriptionDisplays the next comment's page link.block descriptionDisplays the next or previous post link that is adjacent to the current post.block descriptionDisplays the next posts page link.block descriptionDisplays the post count of a taxonomy term.block descriptionDisplays the previous comment's page link.block descriptionDisplays the previous posts page link.block descriptionDisplays the title of a post, page, or any other content-type.block descriptionEdit the different global regions of your site, like the header, footer, sidebar, or create your own.block descriptionEmbed a simple audio player.block descriptionEmbed a video from your media library or upload a new one.block descriptionGather blocks in a layout container.block descriptionGive quoted text visual emphasis. "In quoting others, we cite ourselves." — Julio Cortázarblock descriptionGive special visual emphasis to a quote from your text.block descriptionHelp visitors find your content.block descriptionHide and show additional content.block descriptionInsert additional custom elements with a WordPress shortcode.block descriptionInsert an SVG icon.block descriptionInsert an image to make a visual statement.block descriptionInsert poetry. Use special spacing formats. Or quote song lyrics.block descriptionIntroduce new sections and organize content to help visitors (and search engines) understand the structure of your content.block descriptionPost terms.block descriptionPrompt visitors to take action with a button-style link.block descriptionPrompt visitors to take action with a group of button-style links.block descriptionReuse this design across your site.block descriptionSeparate your content into a multi-page experience.block descriptionSet media and words side-by-side for a richer layout.block descriptionShow a block pattern.block descriptionShow login & logout links.block descriptionShow minutes required to finish reading the post. Can also show a word count.block descriptionStart with the basic building block of all narrative.block descriptionThe author biography.block descriptionThe author name.block descriptionThis block is deprecated. Please use the Avatar block, the Author Name block, and the Author Biography block instead.block descriptionThis block is deprecated. Please use the Columns block instead.block descriptionUse the classic WordPress editor.block descriptionWraps the heading and panel in one unit.block descriptionYour site doesn’t include support for this block.block keywordarchiveblock keywordatomblock keywordblockquoteblock keywordblogblock keywordblogsblock keywordbullet listblock keywordcategoriesblock keywordciteblock keywordcloseblock keywordcontainerblock keywordcustom post typesblock keyworddescriptionblock keyworddisclosureblock keyworddividerblock keyworddocumentblock keyworddownloadblock keywordembedblock keywordequationblock keywordfeedblock keywordfindblock keywordformblock keywordformulablock keywordhorizontal-lineblock keywordhrblock keywordiconblock keywordimageblock keywordimagesblock keywordimgblock keywordlatexblock keywordlinkblock keywordlinksblock keywordlistblock keywordloginblock keywordlogoutblock keywordlyricsblock keywordmathematicsblock keywordmenublock keywordmovieblock keywordmusicblock keywordnavigationblock keywordnext pageblock keywordnumbered listblock keywordordered listblock keywordoverlayblock keywordpageblock keywordpaginationblock keywordpdfblock keywordphotoblock keywordphotosblock keywordpictureblock keywordpodcastblock keywordpoemblock keywordpoetryblock keywordpostsblock keywordread moreblock keywordrecent commentsblock keywordrecent postsblock keywordrecordingblock keywordreferencesblock keywordreusableblock keywordrowblock keywordsectionblock keywordsongblock keywordsoundblock keywordstanzablock keywordsubtitleblock keywordsummaryblock keywordsvgblock keywordtagsblock keywordtaxonomyblock keywordterm titleblock keywordtermsblock keywordtextblock keywordtitleblock keywordtoggleblock keywordverseblock keywordvideoblock keywordwrapperblock style labelDefaultblock style labelDotsblock style labelFillblock style labelLogos Onlyblock style labelOutlineblock style labelPill Shapeblock style labelPlainblock style labelRoundedblock style labelStripesblock style labelWide Lineblock titleAccordionblock titleAccordion Headingblock titleAccordion Itemblock titleAccordion Panelblock titleArchivesblock titleAudioblock titleAuthor (deprecated)block titleAuthor Biographyblock titleAuthor Nameblock titleAvatarblock titleBreadcrumbsblock titleButtonblock titleButtonsblock titleCalendarblock titleClassicblock titleCodeblock titleColumnblock titleColumnsblock titleComment Author Nameblock titleComment Contentblock titleComment Dateblock titleComment Edit Linkblock titleComment Reply Linkblock titleComment Templateblock titleCommentsblock titleComments Countblock titleComments Formblock titleComments Linkblock titleComments Next Pageblock titleComments Page Numbersblock titleComments Paginationblock titleComments Previous Pageblock titleComments Titleblock titleContentblock titleCoverblock titleCustom HTMLblock titleCustom Linkblock titleDateblock titleDetailsblock titleEmbedblock titleExcerptblock titleFeatured Imageblock titleFileblock titleFootnotesblock titleGalleryblock titleGroupblock titleHeadingblock titleHome Linkblock titleIconblock titleImageblock titleLatest Commentsblock titleLatest Postsblock titleLegacy Widgetblock titleListblock titleList Itemblock titleLogin/outblock titleMathblock titleMedia & Textblock titleMoreblock titleNavigationblock titleNavigation Overlay Closeblock titleNext Pageblock titleNo Resultsblock titlePage Breakblock titlePage Listblock titlePage List Itemblock titlePage Numbersblock titlePaginationblock titleParagraphblock titlePatternblock titlePattern Placeholderblock titlePoetryblock titlePost Navigation Linkblock titlePost Templateblock titlePost Termsblock titlePreformattedblock titlePrevious Pageblock titlePullquoteblock titleQuery Loopblock titleQuery Titleblock titleQuery Totalblock titleQuoteblock titleRSSblock titleRead Moreblock titleSearchblock titleSeparatorblock titleShortcodeblock titleSite Logoblock titleSite Taglineblock titleSite Titleblock titleSocial Iconblock titleSocial Iconsblock titleSpacerblock titleSubmenublock titleTableblock titleTag Cloudblock titleTemplate Partblock titleTerm Countblock titleTerm Descriptionblock titleTerm Nameblock titleTerm Templateblock titleTerms Listblock titleTerms Queryblock titleText Columns (deprecated)block titleTime to Readblock titleTitleblock titleUnsupportedblock titleVideoblock titleWidget Groupby %scalendar caption%1$s %2$scategoriesMost Usedcategory archive title prefixCategory:close tagsclosing curly double quote&#8221;closing curly single quote&#8217;color schemeDarkcolor schemeLightcomment statusApprovedcomment statusSpamcomment statusTrashcomment_excerpt_length20custom backgroundBackgroundcustom headersPreviously uploadedcustom headersSuggestedcustom image headerHeadercustomizer changeset action/button labelSchedulecustomizer changeset statusScheduleddaily archives date formatF j, Ydate archive title prefixDay:date archive title prefixMonth:date archive title prefixYear:datepicker: navigate to next monthNextdatepicker: navigate to previous monthPreviousdecline months names: on or offoffdefault site languageSite Defaultdomaindouble prime&#8243;editor buttonLeft to righteditor buttonRight to lefteditor buttonShow blocksem dash&#8212;email "From" fieldSite Adminen dash&#8211;excerpt_length55feed link&raquo;file type groupArchivesfile type groupAudiofile type groupVideofind/replaceFindfind/replaceNextfind/replacePrevfind/replaceReplacefind/replaceReplace allfind/replaceReplace withfind/replaceWhole wordsfont categoryDisplayfont categoryHandwritingfont categoryMonospacefont categorySans Seriffont categorySeriffont collection nameGoogle Fontsfont-face declaration in theme.json format, encoded as a string.font-face declaration in theme.json format.font-face definition in theme.json format.font-family declaration in theme.json format, encoded as a string.font_face_settings parameter must be a valid JSON string.g:i agenitiveAprilgenitiveAugustgenitiveDecembergenitiveFebruarygenitiveJanuarygenitiveJulygenitiveJunegenitiveMarchgenitiveMaygenitiveNovembergenitiveOctobergenitiveSeptemberhorizontal table cell alignmentH Alignhtml_lang_attributehttps://developer.wordpress.org/advanced-administration/debug/debug-network/https://developer.wordpress.org/advanced-administration/debug/debug-wordpress/https://developer.wordpress.org/advanced-administration/security/https/https://developer.wordpress.org/advanced-administration/wordpress/cookies/https://developer.wordpress.org/advanced-administration/wordpress/cookies/#enable-cookies-in-your-browserhttps://developer.wordpress.org/advanced-administration/wordpress/css/https://developer.wordpress.org/advanced-administration/wordpress/wp-config/https://developer.wordpress.org/reference/functions/is_main_query/https://developer.wordpress.org/themes/advanced-topics/child-themes/https://learn.wordpress.org/https://wordpress.org/https://wordpress.org/documentation/https://wordpress.org/documentation/article/customize-permalinks/#choosing-your-permalink-structurehttps://wordpress.org/documentation/article/faq-troubleshooting/https://wordpress.org/documentation/article/manage-wordpress-widgets/https://wordpress.org/documentation/article/reset-your-password/https://wordpress.org/documentation/article/settings-general-screen/#email-addresshttps://wordpress.org/documentation/article/site-editor/https://wordpress.org/support/forum/requests-and-feedbackhttps://wordpress.org/support/forums/https://www.sitemaps.org/https://www.w3.org/WAI/tutorials/images/decision-tree/icon labelArrow Downicon labelArrow Down Lefticon labelArrow Down Righticon labelArrow Lefticon labelArrow Righticon labelArrow Upicon labelArrow Up Lefticon labelArrow Up Righticon labelAt Symbol (@)icon labelAudioicon labelBellicon labelBlock Defaulticon labelBlock Metaicon labelBlock Tableicon labelCalendaricon labelCapture Photoicon labelCapture Videoicon labelCarticon labelCategoryicon labelCautionicon labelChart Baricon labelCheckicon labelChevron Downicon labelChevron Down Smallicon labelChevron Lefticon labelChevron Left Smallicon labelChevron Righticon labelChevron Right Smallicon labelChevron Upicon labelChevron Up Downicon labelChevron Up Smallicon labelCommenticon labelCovericon labelCreateicon labelDesktopicon labelDownloadicon labelDrawer Lefticon labelDrawer Righticon labelEnvelopeicon labelErroricon labelExternalicon labelFileicon labelGalleryicon labelGroupicon labelHeadingicon labelHelpicon labelHomeicon labelImageicon labelInfoicon labelKeyicon labelLanguageicon labelMap Markericon labelMenuicon labelMobileicon labelMore Horizontalicon labelMore Verticalicon labelNexticon labelParagraphicon labelPaymenticon labelPencilicon labelPeopleicon labelPlusicon labelPlus Circleicon labelPreviousicon labelPublishedicon labelQuoteicon labelRSSicon labelReceipticon labelScheduledicon labelSearchicon labelSettingsicon labelShadowicon labelShareicon labelShieldicon labelShuffleicon labelStar Emptyicon labelStar Filledicon labelStar Halficon labelStoreicon labelStylesicon labelSymbolicon labelSymbol Filledicon labelTableicon labelTableticon labelTagicon labelTipicon labelUploadicon labelVersekeyboard shortcut to open the command paletteCtrl+Kkeyboard shortcut to open the command palette⌘Kl, F jS, YlabelSearch for:label before the title of the next postNext:label before the title of the previous postPrevious:label for button in the audio widgetAdd Audiolabel for button in the audio widget; should preferably not be longer than ~13 characters longEdit Audiolabel for button in the audio widget; should preferably not be longer than ~13 characters longReplace Audiolabel for button in the gallery widget; should not be longer than ~13 characters longAdd Imageslabel for button in the gallery widget; should not be longer than ~13 characters longEdit Gallerylabel for button in the image widgetAdd Imagelabel for button in the image widget; should preferably not be longer than ~13 characters longEdit Imagelabel for button in the image widget; should preferably not be longer than ~13 characters longReplace Imagelabel for button in the media widgetAdd Medialabel for button in the media widget; should preferably not be longer than ~13 characters longEdit Medialabel for button in the media widget; should preferably not be longer than ~13 characters longReplace Medialabel for button in the video widgetAdd Videolabel for button in the video widget; should preferably not be longer than ~13 characters longEdit Videolabel for button in the video widget; should preferably not be longer than ~13 characters longReplace Videolabel for custom colorCustom...label for hide controls button without length constraintsHide Controlslabel for hide controls button without length constraintsShow Controlslabel for next post linkNextlabel for previous post linkPreviouslinks widgetAll Linkslist styleCirclelist styleDefaultlist styleDisclist styleLower Alphalist styleLower Greeklist styleLower Romanlist styleSquarelist styleUpper Alphalist styleUpper Romanlocalized PHP upgrade information pagehttps://wordpress.org/support/update-php/mediaRemove video trackmedia itemsMinemedia itemsUnattachedmedia modal menuMenumedia modal menu actionsActionsmenu(Currently set to: %s)menu location(Current: %s)menu locations(If you plan to use a menu <a href="%1$s" %2$s>widget%3$s</a>, skip this step.)menu locationsHere&#8217;s where this menu appears. If you would like to change that, pick another location.menu locationsView All Locationsmenu locationsView Locationmenu locationsWhere do you want this menu to appear?minimum input length for searching post links3missing menu item navigation label(no label)monthly archives date formatF Ymoved to the Trash.nav menu home labelHomenavigation link block descriptionA link to a category.navigation link block descriptionA link to a page.navigation link block descriptionA link to a post.navigation link block descriptionA link to a tag.navigation link block titleCategory Linknavigation link block titlePage Linknavigation link block titlePost Linknavigation link block titleTag Linknew WordPress Loopnext image in lightboxNextnext set of postsNextnounCommentnounSite Icon PreviewnounTrashnounUploadnumber_format_decimal_pointnumber_format_thousands_sepoEmbed ResponseoEmbed ResponsesoEmbed resource link nameoEmbed (JSON)oEmbed resource link nameoEmbed (XML)ofopening curly double quote&#8220;opening curly single quote&#8216;pageFeatured imagepageRemove featured imagepageSet featured imagepageUse as featured imagepaging%1$s of %2$spassword mismatchMismatchpassword strengthMediumpassword strengthPassword strength unknownpassword strengthStrongpassword strengthVery weakpassword strengthWeakplaceholderSearch &hellip;playlist item title&#8220;%s&#8221;pmpostFeatured imagepostRemove featured imagepostSet featured imagepostUse as featured imagepost formatFormatpost formatFormatspost format archive titleAsidespost format archive titleAudiopost format archive titleChatspost format archive titleGalleriespost format archive titleImagespost format archive titleLinkspost format archive titleQuotespost format archive titleStatusespost format archive titleVideospost password formEnterpost statusDraftpost statusPendingpost statusPrivatepost statusPublishedpost statusScheduledpost statusTrashpost type archive title prefixArchives:post type general nameChangesetspost type general nameGlobal Stylespost type general nameMediapost type general nameNavigation Menuspost type general namePagespost type general namePatternspost type general namePostspost type general nameTemplate Partspost type general nameTemplatespost type singular nameChangesetpost type singular nameNavigation Menupost type singular namePagepost type singular namePatternpost type singular namePostpost type singular nameTemplatepost type singular nameTemplate Partprevious image in lightboxPreviousprevious set of postsPreviousprime&#8242;put your unique phrase hererequest statusCompletedrequest statusConfirmedrequest statusFailedrequest statusPendingresolved/reopenedrevision date formatF j, Y @ H:i:ssite&larr; Go to %ssitenamesocial link block variation name500pxsocial link block variation nameAmazonsocial link block variation nameBandcampsocial link block variation nameBehancesocial link block variation nameBlueskysocial link block variation nameCodePensocial link block variation nameDeviantArtsocial link block variation nameDiscordsocial link block variation nameDribbblesocial link block variation nameDropboxsocial link block variation nameEtsysocial link block variation nameFacebooksocial link block variation nameFlickrsocial link block variation nameFoursquaresocial link block variation nameGitHubsocial link block variation nameGoodreadssocial link block variation nameGooglesocial link block variation nameGravatarsocial link block variation nameInstagramsocial link block variation nameLast.fmsocial link block variation nameLinksocial link block variation nameLinkedInsocial link block variation nameMailsocial link block variation nameMastodonsocial link block variation nameMediumsocial link block variation nameMeetupsocial link block variation namePatreonsocial link block variation namePinterestsocial link block variation namePocketsocial link block variation nameRSS Feedsocial link block variation nameRedditsocial link block variation nameShare Iconsocial link block variation nameSkypesocial link block variation nameSnapchatsocial link block variation nameSoundCloudsocial link block variation nameSpotifysocial link block variation nameTelegramsocial link block variation nameThreadssocial link block variation nameTikToksocial link block variation nameTumblrsocial link block variation nameTwitchsocial link block variation nameTwittersocial link block variation nameVKsocial link block variation nameVimeosocial link block variation nameWhatsAppsocial link block variation nameWordPresssocial link block variation nameXsocial link block variation nameYelpsocial link block variation nameYouTubespellcheckFinishspellcheckIgnorespellcheckIgnore allsub itemsubmit buttonSearchtable bodyBodytable cellCelltable cell alignment attributeNonetable cell scope attributeScopetable footerFootertable headerHeadertag archive title prefixTag:tag delimiter,tagsMost Usedtaxonomy general nameCategoriestaxonomy general namePattern Categoriestaxonomy general nameTagstaxonomy singular nameCategorytaxonomy singular namePattern Categorytaxonomy singular nameTagtaxonomy template name%s Archivestaxonomy term archive title prefix%s:template part areaFootertemplate part areaGeneraltemplate part areaHeadertemplate part areaNavigation Overlaytext directiontext directionltrtheme<strong>Error:</strong> Current PHP version does not meet minimum requirements for %s.theme<strong>Error:</strong> Current WordPress and PHP versions do not meet minimum requirements for %s.theme<strong>Error:</strong> Current WordPress version does not meet minimum requirements for %s.themeActivate %sthemeChangethemeInstalledthemePreviewing:theme authorBy %stranslationsAvailabletranslationsInstalledunit symbolBunit symbolEBunit symbolGBunit symbolKBunit symbolMBunit symbolPBunit symbolTBunit symbolYBunit symbolZBuntitled post %suser dropdown%1$s (%2$s)verbPreviewverbReplyverbTrashverbUploadvertical table cell alignmentV Alignvideo or audioLengthwidgets%1$s on %2$syearly archives date formatY… <a class="wp-block-latest-posts__read-more" href="%1$s" rel="noopener noreferrer">Read more<span class="screen-reader-text">: %2$s</span></a>PO-Revision-Date: 2026-05-20 13:47:19+0000
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=2; plural=n > 1;
X-Generator: GlotPress/4.0.3
Language: tr
Project-Id-Version: WordPress - 7.0.x - Development
 e-posta göndericisi desteklenmiyor.%2$s %3$s içindeki “%1$s" bir hex ya da rgb dizgesi değil."%1$s", desteklenen bir wp_template_part alan değeri değil ve "%2$s" olarak eklendi."%1$s" betiği yeni bileşen düzenleyicisi ile birlikte kullanılmamalıdır. (%2$s veya %3$s)."%1$s" biçemi  yeni bileşen düzenleyicisi ile birlikte kullanılmamalıdır. (%2$s veya %3$s).#%d (başlık yok)$store bir WP_Style_Engine_CSS_Rules_Store kopyası olmalıdır%1$s %2$d%1$s %2$s %3$s %4$s akışı%1$s %2$s %3$s kategori akışı%1$s %2$s %3$s yorum akışı%1$s %2$s %3$s akışı%1$s %2$s %3$s etiket akışı%1$s %2$s yorum akışı%1$s %2$s akışı%3$s akışı için %1$s %2$s yazıları%1$s %2$s &#8220;%3$s&#8221; akışı için arama sonuçları%1$s %2$s, %3$s önce (%4$s)%1$s &lsaquo; %2$s &#8212; WordPress%1$s (%2$d)%1$s (%2$s)%1$s (%2$s sürümünden başlayarak; %3$s)%1$s (%2$s sürümünden başlayarak; uygun alternatif yok)%1$s (%2$s sürümünden başlayarak; yerine %3$s kullanın)%1$s > %2$s<span class="screen-reader-text">%2$s için</span> %1$s yorum<span class="screen-reader-text">%2$s için</span> %1$s yorum%1$s ve %2$s%1$s, %2$s%1$s x %2$s pixel<span class="screen-reader-text">%2$s ile ilgili </span>%1$s yorum<span class="screen-reader-text">%2$s ile ilgili </span>%1$s yorum%1$s oluşturulamadı: %2$s%1$s, %2$s modeliyle eşleşmiyor.%1$s beklenen biçim ile eşleşmiyor. Nedeni: %2$s%1$s, %2$s için gerekli bir özelliktir.%1$s kullanımdan kaldırıldı. Bunun yerine %2$s kullanılıyor.%1$s kullanımdan kaldırıldı. Yerine %2$s kullanın.%1$s, %2$s değil.%1$s parametresi geçerli %2$l değil.%1$s parametresi geçerli bir %2$s değil. Nedeni: %3$s%1$s nesnenin geçerli bir özelliği değil.%1$s %2$s türünde değil.%1$s, %2$l içinden bir değer değil.%1$s bir %2$s değil.%1$s %2$s ile gururla sunuluyor%1$s yeni siteniz. Geçerli parolanız ile &#8220;%3$s&#8221; olarak <a href="%2$s">oturum açabilirsiniz</a>.%1$s, %2$l taneyle eşleşiyor, ama yalnızca bir tanesiyle eşleşmeliydi.%1$s parametresi %2$s çarpanı olmalıdır.%1$s en az %2$s karakter uzunluğunda olmalıdır.%1$s en az %2$s karakter uzunluğunda olmalıdır.%1$s en fazla %2$s karakter uzunluğunda olmalıdır.%1$s en fazla %2$s karakter uzunluğunda olmalıdır.%1$s, %2$d (katılmaz) ve %3$d (katılmaz) arasında olmalıdır.%1$s %2$d (katılmaz) ile %3$d (katılır) arasında olmalıdır%1$s %2$d (katılır) ile %3$d (katılmaz) arasında olmalıdır%1$s %2$d (katılır) ile %3$d (katılır) arasında olmalıdır%1$s %2$d değerinden büyük olmalıdır%1$s %2$d değerinden büyük ya da eşit olmalıdır%1$s, %2$d değerinden küçük olmalıdır%1$s, %2$d değerinden küçük ya da eşit olmalıdır%1$s içinde en az %2$s öge bulunmalıdır.%1$s içinde en az %2$s öge bulunmalıdır.%1$s parametresinde en az %2$s özellik bulunmalıdır.%1$s parametresinde en az %2$s özellik bulunmalıdır.%1$s içinde en fazla %2$s öge bulunmalıdır.%1$s içinde en fazla %2$s öge bulunmalıdır.%1$s parametresinde en fazla %2$s özellik bulunmalıdır.%1$s parametresinde en fazla %2$s özellik bulunmalıdır.%1$s - %2$s%1$s için yalnızca boş olmayan bir yol dizgesi kabul edilir. %2$s alındı.%1$s ya da %2$s%2$s için %1$s yanıt%2$s için %1$s yanıt"%2$s" ögesine %1$s yanıt"%2$s" ögesine %1$s yanıt%1$s "%2$s" değeri geçerli bir adres ya da dosya referansı olmalıdır.%1$s, %2$s%1$s ve %2$s%1$s-%2$s%1$s: %2$s%d eklenti güncellemesi%d eklenti güncellemesi%d tema güncellemesi%d tema güncellemesi%d WordPress güncellemesi%d gün%d saat%d dakika%d ay%d sonuç bulundu%d sonuç bulundu%d saniye%d seçilmiş%d tema bulundu%d yıl%s (Geçersiz)%s (Bekliyor)%s <span class="says">dedi ki:</span>%s <span class="screen-reader-text">Yorum</span>%s <span class="screen-reader-text">Yorum</span>%s API anahtarı%s avatarı%s yorum%s yorum%s yorum inceleniyor%s yorum inceleniyor%s [Otomatik kayıt]%s [geçerli sürüm]%s önce%s boş olamaz.%s güncellenemedi.%s karakter%s karakter%s yorum%s yorum%s gün%s gün%s beklenen biçimlerin hiçbiriyle eşleşmiyor.%s çoklu yükleyiciyi ile yüklenebilecek en büyük dosya boyutunu aşıyor.%s bu siteye yüklenebilecek en büyük dosya boyutunu aşıyor.Görsel akışa yazılırken %s başarısız oldu.Bugünden %s%s içinde çift ögeler var.%s devraldı ve şu anda özelleştiriyor.%s saat%s saat%s korunan bir WordPress ayarıdır ve üzerinde değişiklik yapılmamalıdırŞu anda %s bu değişiklik kümesini özelleştiriyor. Devralmak ister misiniz?%s şu anda bu değişiklik kümesini özelleştiriyor. Özelleştirmeyi denemek için lütfen onun işi bitene kadar bekleyin. Yaptığınız son değişiklikler otomatik olarak kaydedildi.%s zaten bu siteyi özelleştiriyor. Devralmak ister misiniz?%s şu anda bu siteyi özelleştiriyor. Özelleştirmeyi denemek için lütfen onun işi bitinceye kadar bekleyin. Son yaptığınız değişiklikler otomatik olarak kaydedildi.%s yasak%s geçerli bir IP adresi değil.%s geçerli bir UUID değil.Görsel üst verilerini alabilmek için %s gereklidir.yeni kullanıcı adınız: %s%s öge%s öge%s bağlantısı%s parametre beklenen biçimlerden bir ya da daha fazlasıyla eşleşiyor.%s dakika%s dakika%s ay%s ay%s temizleme için bir veri tabanı bağlantısı kurmalıdır.%s parametresi geçerli bir JSON dizgesi olmalıdır.%s yanıt%s yanıt%s saniye%s saniye%s alt menüsü%s tema%s güncelleme var%s güncelleme var%s değerleri boş olmayan dizgeler olmalıdır.%s hafta%s hafta%d kelime%d kelime%s yıl%s yıl%s: %l.%sX-Large%sX-Small&#8220;%1$s&#8221; &#8212; %2$s&#8220;%s&#8221; yüklenemedi.&#8592; Ses oynatma listesini iptal et&#8592; Galeriyi iptal et&#8592; Video oynatma listesini iptal et&#8592; Kitaplığa git&hellip;&laquo; Geri&laquo; Eski yorumlar&laquo; Önceki&laquo; Önceki sayfa&larr; Kategorilere dön&larr; Bağlantı kategorilerine git&larr; Model kategorilerine git&larr; Etiketlere git&lt; Önceki&mdash; Seçin &mdash;(%s yazar arşivi, yeni bir sekmede açılır)(%s site bağlantısı, yeni bir sekmede açılır)(Düzenle)(Giriş bağlantısı, yeni sekmede açılır)(Yalnızca küçük harfler ve rakamlardan oluşan en az 4 karakter olmalı.)(Bu ileti %s sürümünde eklendi.)(Eklenmemiş)(Başlıksız)(WordPress, WordPress.org sunucuları ile güvenli bir bağlantı kuramadı. Lütfen sunucu yöneticiniz ile görüşün.)(daha&helliip;)(yazar yok)(başlıksız)(yeni sekmede açılır)*+ %s+ Yeni menü oluştur, 1 Yorum<span class="screen-reader-text">%s için</span> bir yorum: %s<a href="%1$s" %2$s>Görselin amacını nasıl açıklayacağınızı öğrenin%3$s</a>. Görsel yalnızca dekoratif amaçlı ise boş bırakın.<a href="%1$s">Lütfen WordPress sürümünüzü güncelleyin</a> ve sonra <a href="%2$s">PHP güncellemesi ile ilgili ayrıntılı bilgi alın</a>.<a href="%s">PHP güncellemesi ile ilgili ayrıntılı bilgi alın</a>.<a href="%s">Eklentileri yönet</a>.<a href="%s">Lütfen WordPress sürümünü güncelleyin</a>.<strong>%1$s ve %2$s sabitlerinin değerleri çakışıyor</strong> %2$s değerinin alt etki alanı yapılandırma ayarınız olduğu varsayılacak.<strong>%1$s sitesi bulunamadı.</strong> %3$s veri tabanındaki %2$s tablosunda arandı. Doğru mu?<strong>Veri tabanı tabloları eksik.</strong> Bu durum, sunucunuzda veri tabanı sunucusunun çalışmadığı, WordPress kurulumunun düzgün yapılmadığı veya birisinin %s tablosunu sildiği anlamına gelir. Hemen şimdi veri tabanınızı kontrol etmelisiniz.<strong>Hata:</strong> %2$s içindeki %1$s yalnızca rakam, harf ve alt çizgi karakterleri içerebilir.<strong>Hata:</strong> Beklenmeyen bir çıktı yüzünden çerezler engellendi. Yardım almak için lütfen <a href="%1$s">bu belgeye</a> bakın ya da <a href="%2$s">destek forumlarını</a> deneyin.<strong>Hata:</strong> Çerezler engelleniyor ya da tarayıcınız tarafından desteklenmiyor. WordPress kullanabilmek için <a href="%s">çerezleri etkinleştirmelisiniz</a>.<strong>Hata:</strong> Hesabınız açılamadı&hellip; Lütfen <a href="mailto:%s">site yöneticiniz</a> ile görüşün!<strong>Hata:</strong> Kullanıcı adı, e-posta adresi ya da parola geçersiz.<strong>Hata:</strong> Lütfen kullanıcı adı ya da e-posta adresinizi yazın.<strong>Hata:</strong> Lütfen bir kullanıcı adı yazın.<strong>Hata:</strong> Lütfen geçerli bir e-posta adresi yazın.<strong>Hata:</strong> Lütfen gerekli alanları doldurun.<strong>Hata:</strong> Lütfen bir yorum yazın.<strong>Hata:</strong> Lütfen e-posta adresinizi yazın.<strong>Hata:</strong> Yazdığınız site adresi zaten alınmış.<strong>Hata:</strong> Ne yazık ki, bu kullanıcı adına izin verilmiyor.<strong>Hata:</strong> Yorum kaydedilemedi. Lütfen bir süre sonra yeniden deneyin.<strong>Hata:</strong> E-posta adresi kullanılıyor.<strong>Hata:</strong> E-posta adresi hatalı.<strong>Hata:</strong> E-posta gönderilemedi. Siteniz e-posta gönderecek şekilde yapılandırılmamış olabilir. <a href="%s">Parolanızı sıfırlamak için destek alın</a>.<strong>Hata:</strong> E-posta alanı boş.<strong>Hata:</strong> Parola alanı boş.<strong>Hata:</strong> Oturum açarken kullandığınız %s e-posta adresi için yazdığınız parola yanlış.<strong>Hata:</strong> %s kullanıcısı için yazılan parola geçersiz.<strong>Hata:</strong> Parola ile onayı aynı değil.<strong>Hata:</strong> Tema klasörü boş ya da bulunamadı. Lütfen kurulumunuzu kontrol edin.<strong>Hata:</strong> <strong>%s</strong> kullanıcı adı bu sitede kayıtlı değil. Kullanıcı adınızdan emin değilseniz, onun yerine e-posta adresinizi deneyin.<strong>Hata:</strong> Kullanıcı adı alanı boş.<strong>Hata:</strong> Bu kullanıcı adı ya da e-posta adresi ile bir hesap yok.<strong>Hata:</strong> Site kaydı oluşturulurken bir sorun çıktı.<strong>Hata:</strong> Bu e-posta adresi ile zaten bir hesap açılmış. Bu adresle <a href="%s">oturum açın</a> ya da başka bir adres seçin.<strong>Hata:</strong> Bu geçerli bir akış şablonu değil.<strong>Hata:</strong> Bu kullanıcı adı ile bir hesap zaten var. Lütfen başka bir ad seçin.<strong>Hata:</strong> Kabul edilmeyen karakterler içerdiğinden bu kullanıcı adı geçersiz.  Lütfen geçerli bir kullanıcı adı yazın.<strong>Hata:</strong> E-posta adresi bilinmiyor. E-posta adresinizi denetleyin ya da kullanıcı adınızı kullanarak yeniden deneyin.<strong>Hata:</strong> Kullanıcı adı bilinmiyor. Kullanıcı adınızı denetleyin ya da e-posta adresinizi kullanarak yeniden deneyin.<strong>Hata:</strong> Şu anda kullanıcıların hesap açmasına izin verilmiyor.<strong>Hata:</strong> WordPress %1$s için MySQL %2$s ya da üzerindeki bir sürüm gerekli<strong>Hata:</strong> Sitenizin adresi çok uzun.<strong>Hata:</strong> Hesabınız istenmeyen içerik göndericisi olarak işaretlenmiş.<strong>Hata:</strong> Yorumunuz çok uzun.<strong>Hata:</strong> E-posta adresiniz çok uzun.<strong>Hata:</strong> Adınız çok uzun.<strong>Hata:</strong> Parola sıfırlama bağlantınız geçersiz görünüyor. Lütfen aşağıdan yeni bir bağlantı isteğinde bulunun.<strong>Hata:</strong> Parola sıfırlama bağlantınızın süresi dolmuş. Lütfen aşağıdan yeni bir bağlantı isteğinde bulunun.<strong>WordPress güncellendi!</strong> Lütfen yeniden oturum açarak yenilikleri inceleyin.Uygulama tarafından benzersiz olarak tanımlamak için belirtilen bir UUID. URL veya DNS adlandırma alanının bulunduğu bir UUID v5 kullanılması önerilir.Bir WordPress yorumcusuSitenizdeki yazıların takvimi.Sizinle aynı saat diliminde bir il.En çok kullanılan etiketlerin bulutu.Tüm tarih dizgeleri için tarih biçimi.Haftanın hangi günde başlayacağını gösteren günün hafta içindeki numarası.Model açıklaması.Temanın açıklaması.Ayrıntılı değişim açıklaması.Yinelenen bir olay zaten var.Aynı ayarları kullanan bir yazı tipi yüzü zaten var."%s" adres son ekini kullanan bir yazı tipi ailesi zaten var.Yazı türünün insan tarafından okunabilen açıklaması.Sınıflandırmanın insan tarafından okunabilen açıklaması.İnsan tarafından okunabilen değişim başlığı.Bir anahtar - değer uyumsuzluğu ile karşılaşıldı. Lütfen etkinleştirme e-postanızda size gönderilen bağlantıyı açın.Sınamayı açıklayan bir etiket.Model kategorisi bağlantısı.Yazı biçimine bağlantıŞablon parçaları için izin verilen alan değerlerinin listesi.Varsayılan şablon türlerinin listesi.İç bloğun kendi iç bloklarının listesi. Bu, ana innerBlocks şemasını izleyen özyinelemeli bir tanımdır.Sitenizdeki sayfaların listesi.Kategorilerin listesi ya da açılır menüsü.Bir ortam ögesi.Sitenizdeki yazıların aylık arşivi.Sınamanın ne aradığı ve kullanıcı için neden önemli olduğu ile ilgili ayrıntılı bir açıklama.Bu terim için ad gereklidir.Nesnenin adlandırılmış durumu.Yazı için bir adlandırılmış durum.Tema için adlandırılmış durum."%s" yazınızda bir yorum onayınızı bekliyor"%s" yazınızda bir geri bağlantı onay vermenizi bekliyor"%s" yazınızda bir geri izleme onayınızı bekliyorParola ile korunan bir yazı sabitlenemez.İçerik ve özete erişimi korumak için parola.Bir eklenti bu olaya izin vermedi.Bir eklenti, olayın yeniden zamanlanmasını engelledi.Bir eklenti, olayın zamanlanmasını engelledi.Bir eklenti, olayın zamanlanmamış olmasını engelledi.Bir eklenti, kancanın temizlenmesini engelledi.Bir yazı hem sabit olup hem de parola ile korunamaz.%1$s önce bir kurtarma bağlantısı gönderildi. Lütfen yeni bir e-posta istemeden önce %2$s bekleyin.Siteniz için arama formu.Yüksek kaliteli sergilenen model kümesi.Bloğun, insan tarafından okunabilir biçimdeki kısa açıklaması.Bir kurgu kuralında bir "%1$s" ya da bir "%2$s" anahtarı bulunmalıdır. Ancak ikisi birden bulunmamalıdır."%1$s" kaynaklı bir kurgu kuralında bir "%2$s" anahtarı bulunmamalı."%s" kimlikli bir kurgu kuralı zaten var.Sabit bir sayfaSabitlenmiş bir yazı parola ile korunamaz.Özel kalıcı bağlantılar kullanırken bir yapı etiketi gereklidir. <a href="%s">Ayrıntılı bilgi alın</a>Bu sınıflandırmada belirtilen adı taşıyan bir terim zaten var.Bu üst öge ile belirtilen adı taşıyan bir terim zaten var.Tüm zaman dizgeleri için zaman biçimi.Bu sayfada bir başlık bulunamadı.Geçerli bir adres belirtilmemiş.Geçerli bir e-posta adresi gereklidir.Bir değişken uyumsuzluğu ile karşılaşıldı.Site gezinmesini görüntüleyen çeşitli tasarımlar.Ekip üyelerini görüntüleyen çeşitli tasarımlar.Site başlığını ve gezinmesini görüntüleyen çeşitli alt bilgi tasarımları.Site üst bilgisini ve gezinmesini görüntüleyen çeşitli üst bilgi tasarımları.Bir blok bulunan bir bileşen.Yapay zeka özellikleri bu ortamda desteklenmiyor.AM%s bağlayıcısı için API anahtarı.Yetenekler %1$s işlemine kaydedilmelidir. %2$s yeteneği kaydedilmemiş.Yıkıcı işlemler yapan yetenekler için DELETE yöntemi gerekir.Güncelleme yapan yetenekler için POST yöntemi gerekir.Site bilgilerini ve ayarlarını geri getiren veya değiştiren yetenekler.Kullanıcı bilgilerini ve ayarlarını geri getiren veya değiştiren yetenekler."%1$s" geri çağırma işlevi bir istisna oluşturdu: %2$s"%1$s" yeteneğinin girdi geçersiz. Nedeni: %2$s"%1$s" yeteneğinin çıktısı geçersiz. Nedeni: %2$s"%s" yeteneği, belirtilen girişi doğrulamak için gerekli olan giriş şemasını tanımlamamış."%s" yeteneğinde geçerli bir yürütme geri çağrısı yok."%s" yeteneğinin geçerli bir izin geri çağrısı yok."%s" yeteneğinin gerekli izni yok."%s" yeteneği zaten kayıtlı.“%s” yeteneği bulunamadı"%s" yeteneği bulunamadı.“%s” yeteneği izin verilen yetenekler listesinde belirtilmemiş.Ability API, %s işlemi tetiklenmeden önce başlatılmamalıdır.Yetenek kategorileri %1$s işlemine kaydedilmelidir. Yetenek kategorisi %2$s kaydedilmemiş."%1$s" yetenek kategorisi kayıtlı değil. Lütfen "%2$s" yeteneğine atamadan önce yetenek kategorisini kaydedin."%s" yetenek kategorisi zaten kayıtlı."%s" yetenek kategorisi bulunamadı.Yetenek kategorisi bulunamadı.Yetenek kategorisi adres son ekinde yalnızca küçük harf, rakam ve tire karakterleri bulunabilir.Bu yeteneğin bulunduğu yetenek kategorisi.Yetenek adı, namespace ön eki olan bir dizge olmalıdır. Örneğin "my-plugin/my-ability". Yalnızca küçük harfli alfasayısal karakterler, tire ve eğik çizgi karakterlerinden oluşabilir.Yetenek bulunamadı.WordPress hakkındaErişilebilirlikİşlemİşlem onaylandı.İşlemlerEtkinleştirEtkinleştir ve yayınlaEtkinleştirme anahtarı gerekliEtkinleştirme anahtarı:Etkin temaKullanılan tema: %1$s (sürüm %2$s)EtkinlikEkleKategori ekleDeğişiklik kümesi ekleÜst kısım görseli ekleGörsel ekleÖge ekleBağlantı ekleBağlantı kategorisi ekleOrtam ekleOrtam dosyası ekleMenü ögesi ekleGezinme menüsü ekleSayfa ekleModel ekleYazı ekleEtiket ekleŞablon ekleŞablon parçası ekleBir bileşen ekleKenar çubuğuna yeni bir gezinme menüsü ekler.En iyi HTML5 oynatımı için alternatif kaynaklar ekleyinSes kaynağı ekleOrtam ekleMenü elemanı ekle ya da kaldırModel kategorileri ekle ya da kaldırEtiket ekle ya da kaldırAlt yazı ekleBaşlık ekleSes oynatma listesine ekleSözlüğe ekleMenüye ekleBileşene ekleSes oynatma listesine ekleGaleriye ekleMenü ekle: %1$s (%2$s)Video oynatma listesine ekleVideo listesine ekleVideo kaynağı ekleSitenizin görünümünü ve yerleşimini değiştirmek için kendi CSS kodunuzu buraya ekleyin.EklendiEklendi:Sitenizi yavaşlatan bir döngüye yol açabileceği için bu sitenin giriş sayfasına RSS özet akışının eklenmesi desteklenmiyor. Sitedeki yazıları listelemek için <strong>Son yazılar</strong> bloğu gibi başka bir blok kullanmayı deneyin.Ek CSSEk SMTP bilgileri: Bu galeriye ek görseller eklendi: %sBulunan ek öge sayısı: %dEk kısayollar,Yönetim e-posta adresi doğrulamaGelişmişGelişmiş seçeneklerAfrikancaAkismet Anti-spamArnavutçaAlbümHizalaOrtalaSola yaslaSağa yaslaHizalamaYokTüm kategorilerTüm değişim kümeleriTüm bağlantı kategorileriTüm sayfalarTüm modellerTüm yazılarTüm etiketlerKullanıcıya atanmış tüm yetkinlikler.Yazı türü tarafından kullanılan tüm yetkinlikler.Sınıflandırma tarafından kullanılan tüm yetkinlikler.Tüm tarihlerBu yazı türü tarafından desteklenen tüm özellikler.Tüm ortam ögeleriGerekli tüm eklentiler kuruldu ve etkinleştirildi.İzin verYeni yazılara yorum yapılabilsinDiğer bloglardan yeni makaleler için bağlantı bildirimleri (geri bağlantılar ve geri izlemeler) yapılabilsin.Diğer bloglardan yeni yazılar için bağlantı bildirimleri (geri bağlantılar ve geri izlemeler) yapılabilsin.Yeni kullanıcılar hesap açabilsinİnsanlar yeni yazılara yorum yapabilsin.Arama motorları bu siteyi dizine ekleyebilsin.İzin verilen dosyalarKullanılabilecek alt blok türleri.Arama formları, yorum formları, yorum listeleri, galeri ve görsel yazısı için HTML5 biçimlendirmesinin kullanılmasına izin verir.Zaten kurulmuşAlternatif metinAlternatif metinAlternatif kaynakEk dosya görüntülenemediğinde görüntülenecek alternatif metin.Hiyerarşik sınıflandırmada yinelenen bir ad kullanıldı. Lütfen ad yerine terim kimliğini kullanın.Menü konumunun alfasayısal tanımlayıcısı.Yazı türünün alfasayısal tanımlayıcısı.Yazının türüne özgü benzersiz alfasayısal tanımlayıcısı.Sürümün türüne özgü benzersiz alfasayısal tanımlayıcısı.Durumun alfasayısal tanımlayıcısı.Sınıflandırmanın alfasayısal tanımlayıcısı.Terimin türüne özgü benzersiz alfasayısal tanımlayıcısı.Kullanıcının alfasayısal tanımlayıcısı.Uygulama parolası oluşturmak için bir uygulama adı gereklidir.Modelin birlikte kullanımını kısıtlayan yazı türlerinin bulunduğu bir dizi.Modelin uyduğu şablon türlerinin dizisi.Yazı kapsayıcı bileşeni için sınıf adlarından oluşan bir dizi.Bir sorun çıktı. Akışın çalışmadığı anlaşılıyor. Lütfen bir süre sonra yeniden deneyin.Bir sorun çıktı. Lütfen sayfayı yenileyip yeniden deneyin.Siz bu siteye eklenirken bir sorun çıktı. <a href="%s">Giriş sayfasına</a> git.Etkinleştirme sırasında bir sorun çıktıYükleme sırasında bir sorun çıktı. Lütfen bir süre sonra yeniden deneyin.Özelleştirme sırasında bir sorun çıktı. Lütfen sayfayı yenileyip yeniden deneyin.Yorumunuz işlenirken bir sorun çıktı. Lütfen tüm alanların doğru doldurulduğundan emin olun ve yeniden deneyin.İsteğiniz işlenirken bir sorun çıktı. Lütfen bir süre sonra yeniden deneyin.Bir sorun çıktı.Bir sorun çıktı. Lütfen yeniden deneyin.%3$s dosyasının %2$s satırında %1$s türünde bir sorun çıktı. Hata iletisi: %4$sBir görsel aynı anda hem geç yüklenir hem de yüksek öncelikli olarak ayarlanmamalıdır.Bu e-posta adresi için tamamlanmamış bir kişisel gizlilik isteği zaten var.Beklenmeyen bir sorun çıktı. WordPress.org ile ya da bu sunucunun yapılandırması ile ilgili bir şeyler yanlış olabilir. Sorun sürerse lütfen <a href="%s">destek forumlarını</a> deneyin.Ata bloklar.Derece olarak saat yönünde döndürme açısı.Yeteneğin açıklamaları.AnonimKullanıcıya atanmış herhangi ek yetkinlikler.Uygulama simgesi ön izlemesi: Geçerli görsel: %sUygulama simgesi ön izlemesi: Geçerli görselin alternatif metni yok. Dosya adı: %sGörünümUygulama parolası bulunamadı.Uygulama parolaları hesabınız için kullanılamaz. Yardım almak için lütfen site yöneticisiyle görüşün.Uygulama parolaları kullanılamıyor.UygulaOnayla: %sNisanNisArapçaİsteğe bağlı HTML kodu.İsteğe bağlı metin.Arşiv <span class="count">(%s)</span>Arşivler <span class="count">(%s)</span>ArşivlerVar olduğundan emin misiniz?Veri tabanı sunucusunun ağır yük altında olmadığından emin misiniz?Veri tabanı sunucusunun çalıştığından emin misiniz?Kullanıcı adı ve parolanızın doğru olduğundan emin misiniz?Sunucu adını doğru yazdığınıza emin misiniz?Bu temayı silmek istediğinize emin misiniz?Yayınlanmamış değişikliklerinizi iptal etmek istediğinize emin misiniz?Bunu yapmak istediğinize emin misiniz?%s bağımsız değişkeni kullanımdan kaldırılmıştırBağımsız değişkenler hem tanımlayıcı hem de değer olarak hazırlanamaz. Aşağıdaki çakışmalar bulundu: %sAranacak sütun adları dizisi.Görsel düzenlemeleri dizisi.SanatçıGörsel yüzdesi olarak, görüntünün kırpılacağı yükseklik. KULLANIMDAN KALDIRILDI: Bunun yerine `modifiers` kullanın.Görsel yüzdesi olarak, görüntünün kırpılacağı genişlik. KULLANIMDAN KALDIRILDI: Bunun yerine `modifiers` kullanın.Görsel yüzdesi olarak, kırpmanın başlayacağı x konumu. KULLANIMDAN KALDIRILDI: Bunun yerine `modifiers` kullanın.Görsel yüzdesi olarak, kesmenin başlayacağı y konumu. KULLANIMDAN KALDIRILDI: Bunun yerine `modifiers` kullanın.Uygulama simgesi ve tarayıcı simgesi olarak.ArtanKlasik - 3:2Klasik Portre - 2:3Portre - 3:4Kare - 1:1Standart - 4:3Uzun - 9:16Geniş - 16:9Bir hiyerarşi oluşturmak için bir üst terim atayın. Örneğin Jazz terimi Bebop ve Big Band için üst terim olabilir.Ek dosya öznitelikleriEk dosya bilgileriEk dosya görüntüleme ayarlarıEk dosya sayfasıEk dosya sayfalarıEk dosya ön izlemeEk dosya bilgileriBayt olarak, ek dosya boyutu.Ek dosya yazı kimliğiEk dosya türü.Görsel kalitesi aralığın dışında ayarlanmaya çalışıldı [1,100].Geçerli bir dönüş yordamı olmayan bir kısa kod eklemeye çalışıyorsunuz: %sÖzelliklerBloğun öznitelikleri.Ses dosyasıSes dosyası <span class="count">(%s)</span>Ses dosyası <span class="count">(%s)</span>Ses oynatıcıSes bileşeniSes bileşeni (%d)Ses bileşeni (%d)Ses bilgileriSes başlığıSes başlığı&hellip;AğustosAğuYazarKullanıcının yazar adresi.Yazar:Yazar: %1$s (IP adresi: %2$s, %3$s)Yazar: %sÜst düzey sayfalar bu menüye otomatik olarak eklensinOtomatik paragraf ekleOtomatik oynat%d piksel görsel boyutlu avatar adresi.Yorum yazarının avatar adresi.Kullanıcının avatar adresi.GeriArka plan rengiArka plan görseliHazır ayarArka plan rengiKopya ayarlarının Base64 ile kodlanmış hali.Beyaz RusçaBağlayıcı olay tanıtıcı öznitelikleri desteklenmiyor. Lütfen bunun yerine "%s" kullanın.Bit hızıBit hızı kipiBit hızı:SiyahBlavatarBlok"%1$s" bloğunda "%2$s" adında bir biçem yok."%1$s" bloğu, %4$s altındaki %3$s dosyası için %2$s desteği veriyor. %2$s desteği artık %5$s altında veriliyor.Blok HTML:Blok öznitelikleri."%s" blok bağlaması bulunamadı."%s" blok bağlama zaten kaydedilmiş.Blok bağlama kaynağı adı bir dizge olmalıdır.Blok bağlama kaynağı adlarında bir adlandırma alanı ön eki bulunmalıdır. Örnek: benim-eklentim/benim-ozel-kaynagimBlok bağlama kaynağı adlarında büyük harf bulunmamalıdır.Blok kategorisi.Blok örneği.Blok anahtar sözcükleri.Blok meta veri koleksiyonları aşağıdaki dizinlerden biri veya bunların üst dizinleri olarak kaydedilemez: %sBlok adı bir dizi veya metin olmalıdır.Blok adı.Blok adlandırma alanı.HakkındaSesAfişlerDüğmelerEylem çağrısıSütunlarİletişimÖne çıkarılmışAlt bilgilerGaleriÜst bilgilerOrtamGezinmePortföyYazılarHizmetlerEkipDeneyimlerMetinVideolar"%s" blok modeli kategorisi bulunamadı.Blok modeli kategori adı bir dizge olmalıdır.IzgaraGörsel soldaBüyük başlıkGezinme kaplamasıKaydırmaSiyah arka planlı kaplamaOrtalanmış gezinme ile kaplamaTuruncu arka planlı kaplamaSite bilgileri ve CTA olan kaplamaKüçük görsel ve başlıkPaylaşılan arka plan rengini kullanan sosyal ağ bağlantılarıStandartBlok biçem adı bir dizge olmalıdır.Blok biçemi adında boşluk bulunmamalıdır.Blok biçemi çeşitleri.Blok desteği."%s" blok türü zaten kaydedilmiş."%s"  blok türü kaydedilmedi.Blok türü adları dizgeler olmalıdır.Blok türü adlarında bir adlandırma alanı ön eki bulunmalıdır. Örnek: benim-eklentim/benim-ozel-blok-turumBlok türü adlarında büyük harf bulunmamalıdır.Modelin birlikte kullanılması amaçlanan blok türleri.Blok değişimleri.AlıntıEn fazla blog sayfaları gözükür.MaviKalınÖnemli içerikleri sergilemek için tasarlanmış kalın bölümler.Yer imleriKenarÇerçeve rengiHem hesap açma hem de son güncellenme tarihleri belirtilmelidir.Hesap açma ve son güncellenme tarihleri geçerli tarihler olmalıdır.AltSol altSağ altSayfa yollarıKısaca işletmenizin ne yaptığını ve nasıl yardımcı olabileceğinizi açıklayın.Planlanmış bakım çalışması yapıldığından site kullanılamıyor. Birkaç dakika sonra yeniden bakın.KahverengiTarayıcı simgesi ön izlemesi: Geçerli görsel: %sTarayıcı simgesi ön izlemesi: Geçerli görselin alternatif metni yok. Dosya adı: %sBulgarcaToplu seçimMadde imli listeFakat, yeni kullanıcı adınızı kullanmaya başlamadan önce, <strong>etkinleştirmeniz gerekiyor</strong>.Ama yeni sitenizi kullanmadan önce <strong>etkinleştirmeniz gerekiyor</strong>.Geliştirici: %sYazar: %sCSS SınıflarıCSS ascent-override değeri.CSS koduCSS descent-override değeri.CSS font-display değeri.CSS font-family değeri.CSS font-feature-settings değeri.CSS font-stretch değeri.CSS font-style değeri.CSS font-variant değeri.CSS font-variation-settings değeri.CSS line-gap-override değeri.CSS size-adjust değeri.CSS unicode-range değeri.Ön bellek anahtarı, bir tam sayı ya da boş olmayan bir dizge olmalıdır, %s belirtilmiş.Ön bellek anahtarı boş bir dizge olmamalıdır.TakvimHTML işlemcisi oluşturmak için oluşturucuyu doğrudan çağırmak yerine %s çağırın.VazgeçDüzenlemekten vazgeçYanıtı iptal etBu türde bir yorum oluşturulamaz.Sürümün bir sürümü oluşturulamazBoş oturum açma adı ile bir kullanıcı oluşturulamaz.Boş bir görünen ad ile kullanıcı oluşturamazsınız.Var olan yorum oluşturulamaz.Var olan yazı oluşturulamaz.Var olan kullanıcı oluşturulamaz.Etkinleştirilmiş bir eklenti silinemez. Lütfen önce etkisizleştirin.Kullanıcı genel biçem sürümleri bulunamadı.Bloğu kendisine bağlayamazsınız.Uygulama parolasına göz atılamaz.WP_Widget kullanmayan bir bileşen üzerinde kopya ön izlenemez.Görsel yeniden boyutlandırılamadı. Genişlik ve yükseklik ayarlanmamış.Veri tabanı seçilemediÖzgün HTML metninde bulunmayan belirteçler üzerine yer imleri ayarlanamadı.WP_Widget kullanmayan bir bileşen üzerinde kopya ayarlanamaz.Değişken ayarlanamadı veya sıfırlanamadı: Üst terim belirlenemedi. Sınıflandırma hiyerarşik değil.Nesneler sabitlenemiyor. Nesneyi önce diziye dönüştürün.`%1$s` öncelik değeri, `%2$s` komut dosyası için sağlanamaz çünkü bu bir takma addır (`src` değeri yoktur).`%2$s` betiği bir takma ad olduğu (`src` değerini içermediği) için bir `%1$s` stratejisi sağlanamadı.Yazı türü görüntülenemedi.Durumu görüntüleyemezsiniz.Alt yazıEk dosyanın veri tabanında bulunan HTML başlığı.Başlık&hellip;Başlıklar/Alt yazılarKatalancaKategorilerYokKategori listesiKategori listesi gezinmesiHücre dolgusuHücre aralığıHücre türüMerkezDeğiştirSıklığı değiştirSesi değiştirDosya değiştirGörseli değiştirLogo değiştirTemayı değiştirVideoyu değiştirDeğişiklikler zaten çöpe atılmış.Değişiklikler çöpe atıldı.Değişiklik kümesi diğer kullanıcı tarafından düzenleniyor.BölümlerYazım denetimiE-posta istemcinizin istenmeyen ya da gereksiz posta klasörlerini kontrol edin. Bazen e-postalar yanlışlıkla bu klasörlere atılabiliyor.E-postanızı kontrol edinOnay bağlantısı için e-postanızı kontrol edin, ardından <a href="%s">oturum açma sayfasına</a> gidin.%s posta kutunuzu kontrol edin ve belirtilen bağlantıya tıklayın.ÇinceÇince (Basitleştirilmiş)Çince (Geleneksel)Ses seçinDosya seçinEn çok kullanılan model kategorilerinden seçinEn çok kullanılan etiketlerden seçinGörsel seçinLogo seçVideo seçinŞehir%1$s sınıfı, %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong> ve herhangi bir alternatifi yok.%1$s sınıfı, %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong>! Yerine %3$s kullanın.Sınıf adıBu menü ögesinin bağlantı bileşeninin sınıf adları.Klasik blok klavye kısayollarıTemizleSonuçları temizleBiçimlemeyi temizleBilgisayarınızdan bir resim dosyası yüklemek için &#8220;Resim Ekle&#8221;ye tıklayın. Temanız, videonuzun boyutuyla eşleşen bir görselle en iyi şekilde çalışır &#8212; mükemmel bir uyum için yükledikten sonra görselinizi kırpabilirsiniz.Bilgisayarınızdan bir resim dosyası yüklemek için &#8220;Resim Ekle&#8221;ye tıklayın. Temanız en iyi şekilde %s piksel başlık yüksekliğine sahip bir görselle çalışır &#8212; mükemmel bir uyum için yükledikten sonra görselinizi kırpabilirsiniz.Bilgisayarınızdan bir resim dosyası yüklemek için &#8220;Resim Ekle&#8221;ye tıklayın. Temanız en iyi şekilde %s piksel başlık boyutlarına sahip bir görselle çalışır &#8212; mükemmel bir uyum için yükledikten sonra görselinizi kırpabilirsiniz.Bilgisayarınızdan bir resim dosyası yüklemek için &#8220;Resim Ekle&#8221;ye tıklayın. Temanız en iyi şekilde %s piksel başlık genişliğine sahip bir görselle çalışır &#8212; mükemmel bir uyum için yükledikten sonra görselinizi kırpabilirsiniz.Yeni menünüze bağlantı eklemeye başlamak için &#8220;Sonraki&#8221; üzerine tıklayın.Cevabı iptal etmek için tıklayın.Site başlığını düzenlemek için tıklayın.Bu bileşeni düzenlemek için tıklayın.Bu menüyü düzenlemek için tıklayın.Bu bileşeni düzenlemek için tıklayın.KapatTüm açık kod imlerini kapatAlıntı kod imini kapatKoyu kod imini kapatMadde imli liste kod imini kapatCode kod imini kapatSilinmiş metin kod imini kapatPencereyi kapatEklenmiş metin kod imini kapatYatık kod imini kapatListe ögesi kod imini kapatMenüyü kapatNumaralı liste kod imini kapatYeniden sıralama kipini kapatPaylaşma penceresini kapatYükleyiciyi kapatCmd + harf:KodKapatRenkSiyahCam göbeği mavimsi griAçık yeşil cam göbeğiCanlı parlak amberParlak canlı turuncuSoluk cam göbeği maviAçık pembeCanlı cam göbeği maviCanlı yeşil cam göbeğiCanlı morCanlı kırmızıBeyazRenklerSütunSütun grubuSütunlar&#8217;tain&#8217;t,&#8217;twere,&#8217;twas,&#8217;tis,&#8217;twill,&#8217;til,&#8217;bout,&#8217;nuff,&#8217;round,&#8217;cause,&#8217;emhakkında,bir,zamanında,com,için,kimden,nasıl,içinde,ve,veya,yada,ya da,ki,ne,www'tain't,'twere,'twas,'tis,'twill,'til,'bout,'nuff,'round,'cause,'emYorum%d yorumu, içinde kişisel veriler bulunduğundan anonim kılınamaz.Yorum yazarıYorum yazarının e-posta adresiYorum yazarının IP adresiYorum yazarının adresiYorum yazarının kullanıcı uygulamasıYorum içeriğiYorum tarihiYorum gönderilemediYorum adresiYorum yazarının adı ve e-postası yazılmalıdır.Yorum alanı izin verilen en fazla uzunluğu aşıyor.Yorum zorunludur.off%1$s yazısına %2$s tarafından yapılan yorumlarYorum durumuYorumlar: %sYorumlarYorumlar akışı<span class="screen-reader-text">%s için</span> yorumlar kapalı%s. yorum sayfasıYorumlar kapatılmış.Yorum akışı%1$s için yorumlar, %2$s üzerinde aranıyor%s için yorumlarYorum gezinmesi%s üzerine yapılmış yorumlar%s yazısına yapılan yorumlarYorum sayfalamasıTopluluk etkinlikleri konumuTamamlanan <span class="count">(%s)</span>Tamamlanan <span class="count">(%s)</span>Koşula bağlı sorgu kod imleri sorgu çalıştırılmadan önce yürütülmezler. Öncesinde her zaman yanlış değerini döndürürler.Yeni parolayı doğrula"%s" işlemini onaylayınZayıf parola kullanılabilsinYönetim e-posta adresinizi doğrulayınOnaylanan <span class="count">(%s)</span>Onaylanan <span class="count">(%s)</span>Tebrikler! Yeni siteniz %s, neredeyse hazır.“%s” bağlayıcısının kimlik doğrulama constant_name değeri boş olmayan bir dizge olmalıdır.“%s” bağlayıcısının kimlik doğrulama env_var_name değeri boş olmayan bir dizge olmalıdır."%s" bağlayıcısının kimlik doğrulama yöntemi "api_key" veya "none" olmalıdır.“%s” bağlayıcısının kimlik doğrulama setting_name değeri boş olmayan bir dizge olmalıdır."%s" bağlayıcısı zaten kaydedilmiş.“%s” bağlayıcısı bulunamadı.Bağlayıcı "%s" eklentisi is_active çağrılabilir olmalıdır."%s" bağlayıcısı için boş olmayan bir "name" dizgesi gereklidir."%s" bağlayıcısı için boş olmayan bir "type" dizgesi gereklidir."%s" bağlayıcısı için bir "authentication" dizisi gereklidir.Bağlayıcı kimliğinde yalnızca küçük harf rakam, tire ve alt çizgi karakterleri bulunabilir.BağlayıcılarOranları sınırlaBlok biçemini tanımlayan tanıtıcıyı içerir.İçerikYorumun içeriği, veri tabanında olduğu gibi.Yazının içeriği, veri tabanında olduğu gibi.Şablonun içeriği, veri tabanında olduğu gibi.İçerik karması beklenenle eşleşmedi.Şablonun içeriği.İçerik, başlık ve özet boş.İçerik:Bu türdeki blokların sunduğu bağlam.Bu türdeki bloklar tarafından devralınan bağlam değerleri.İlerle%s okumayı sürdür:-) ve :-P gibi ifadeleri görüntülerken grafiklere çevir.Çerez denetlenemediÇerez süresi doldu.KopyalandıKopyalandı!KopyalaBağlantıyı kopyalaAdresi panoya kopyalaWordPress sitenizde gömmek için bu adresi kopyalayıp yapıştırınBu kodu sitenize gömmek için kopyalayıp yapıştırınTablo satırını kopyalaÇekirdek simge derlemesi bildirimi boş veya geçersiz.Çekirdek simge derlemesi bildirimi eksik veya okunamadı.Çekirdek simge derlemesi bildirimi her simge için geçerli bir “filePath” sağlamalıdır.Dosyaya erişilemedi: Dosya sistemine ulaşılamadı.Yeniden boyutlandırılan görselin boyutları hesaplanamadıKullanıcı oluşturulamadıUygulama parolası silinemedi.Uygulama parolaları silinemedi.Üst veri değeri veri tabanından silinemedi.Site veri tabanından silinemedi.Yürütülemedi: Bu kimlik ile eşleşen bir uygulama parolası bulunamadı.Belirtilen dizge bulunamadı.%s uzantısı eksik olduğu için XML site haritası oluşturulamadıEk dosya veri tabanına eklenemedi.Yazı veri tabanına eklenemedi.Site veri tabanına eklenemedi.Terim veri tabanına eklenemedi.Terim ilişkisi veri tabanına eklenemedi.Terim sınıflandırması veri tabanına eklenemedi.E-posta işlevi başlatılamadı.Dosya ucu açılamadı.%2$s dosyası için %1$s işleyicisi açılamadı.Yol ayrıştırılamadı.Görsel boyutları okunamadı."%1$s" dosyası blok modeli olarak kaydedilemedi ("%2$s" adres son eki geçersiz)"%s" dosyası blok modeli olarak kaydedilemedi ("adres son eki" alanı eksik)"%s" dosyası blok modeli olarak kaydedilemedi ("Başlık" alanı eksik)Dosya bulunamadığından "%s" dosyası bir blok modeli olarak kaydedilemedi.Site verileri alınamadı.Tablonun karakter kümesi belirlenemedi.%1$s seçeneği temizlenemedi. Hata kodu: %2$sUygulama parolası kaydedilemedi.Paylaşılmış terim ayrıştırılamadı.Geçersiz metin çıkarılamadı.Ek dosya veri tabanında güncellenemedi.Yorum veri tabanında güncellenemedi.Yorum durumu güncellenemedi.Yazı veri tabanında güncellenemedi.Site, veri tabanında güncellenemedi.E-posta son gönderilen zaman güncellenemedi.%s üst veri değeri veri tabanında güncellenemedi.Dosyaya yazılamadı %1$s (%2$s).Dosyaya yazılamadı %sÜlkeOluşturMenü oluşturYeni menü oluşturSite oluşturBir ayar dosyası oluşturBu konum için bir menü oluşturYeni galeri oluşturYeni oynatma listesi oluşturYeni video oynatma listesi oluşturBir site ya da yalnızca bir kullanıcı adı oluşturun:Ses oynatma listesi oluşturGaleri oluşturVideo oynatma listesi oluşturYorum yapabilmek için geçerli bir yazar adı ve e-posta adresi yazılmalıdır.Yorum oluşturulamadı.Hırvatça%1$s kancası için zamanlanmış görevin zamanı ayarlanırken sorun çıktı. Hata kodu: %2$s, Hata iletisi: %3$s, Veri: %4$s%1$s kancası için zamanlanmış görev kapatılırken sorun çıktı. Hata kodu: %2$s, Hata iletisi: %3$s, Veri: %4$sKırpKırpma değişkenleri.Görseli kırpKüçük görseli belirtilen boyutlara göre kırpKırpma türü.Görselinizi kırpınKırpma&hellip;İşleniyor&hellip;Kopya ayarlarının şifrelenmiş karması.Ctrl + Alt + harf:Ctrl + harf:Geçerli yönetim e-postası: %sGeçerli üst bilgiBileşenin geçerli kopya ayarları.Derlemenin geçerli sayfası.Kullanılan eklenti: %1$s (sürüm %2$s)Onaylanmayı bekleyen %s yorum var. Lütfen denetim panosuna bakın:Onaylanmayı bekleyen %s yorum var. Lütfen denetim panosuna bakın:Özel CSSÖzel CSS seçicileri.Özel renklerÖzel HTMLÖzel HTML bileşeniÖzel bağlantıÖzel bağlantılarÖzelÖzel boyutÖzel adresTema tarafından tanımlanmışsa özel arka plan.Özel renkTema tarafından tanımlanmışsa özel renk paleti.Tema tarafından tanımlanmışsa özel yazı tipi boyutları.Tema tarafından tanımlanmışsa özel deişim hazır ayarları.Tema tarafından tanımlanmışsa özel üst bilgi.Tema tarafından tanımlanmışsa özel logo.Tema tarafından tanımlanmış ise özel boşluk boyutları.ÖzelleştirTemayı özelleştir: %sÖzelleştir: %sÖzelleştiriciÖzelleştirmeÖzelleştirilen &#9656; %sKesTablo satırını kesÇekçeDancaBaşlangıçVeri tabanı sorunuTarihTarih biçimiTarih/saatGünEtkisizleştirAralıkAraGirintiyi azaltVarsayılanVarsayılan AvatarVarsayılanVarsayılan yazı kategorisi.Varsayılan yazı biçimi.Varsayılan kısayollar,Varsayılan şablonSilMenüyü silSütun silSil: %sKalıcı olarak silSatırı silTabloyu silŞu yazar silindi: %sSilinmiş metin (üstü çizili)Silindi:AzalanAçıklamaEk dosyanın açıklaması, veri tabanında olduğu gibi .Blok türünün açıklaması.Kenar çubuğunun açıklaması.Şablonun açıklaması.Yeteneğin açıklaması.Kategorinin açıklaması.Kullanıcının açıklaması.Bileşenin açıklaması.Seçimi kaldırDosya akışı için belirtilen hedef klasör yok ya da yazılabilir değil.AyırAyrıntı: AyrıntılarOrtam dosyasının türüne özgü bilgiler.Tema bilgileri: %sModelin yerleştiricide görünür olup olmadığını belirler.HTML kodu mu yapıştırdınız?Artık &#8220;Özel HTML&#8221; bileşenimiz olduğunu biliyor muydunuz? &#8220;<a class="add-widget" href="#">Bir bileşen ekle</a>&#8221; düğmesine basıp &#8220;HTML&#8221; yazarak arayabilirsiniz. İnceleyin ve sitenize özel kod yerleştirmek için kullanın!Artık &#8220;Özel HTML&#8221; bileşenimiz olduğunu biliyor musunuz? Bu ekrandaki kullanılabilecek bileşenleri tarayarak bulabilirsiniz. İnceleyin ve sitenize özel kod yerleştirmek için kullanın!Ses bulunan farklı yerleşimler.Video ve ses bulunan farklı yerleşimler.Video bulunan farklı yerleşimler.Görsellerin görüntülenmesi için farklı yerleşimler.BoyutlarÖlçüler:Klasör boyutları döndürülemedi.EtkisizleştirDeğişiklikleri iptal etTartışmaGizleHataları gizleGörünüm ayarlarıSite başlığı ve sloganını görüntüleŞu sınıflandırma ile ilişkilendirilmiş terimlerin listesini görüntüle: %sAçılır menü olarak görüntüleVarsa ögenin yazarı görüntülensin mi?Öge içeriği görüntülensin mi?Öge tarihi görüntülensin mi?Yeteneğin görüntülenecek etiketi.Kategorinin görüntülenecek etiketi.%1$s %2$sYorum yazarının görüntülenecek adı.Kullanıcının görüntülenecek adı.Yazı tarihi görüntülensin mi?İletişim bilgilerinizi görüntüler.Son yazılarınızı liste, ızgara ya da diğer yerleşimlerde görüntüler.%1$s/%2$s gösteriliyor%3$s yazıdan %1$s - %2$s arasındakiler görüntüleniyor%d tema görüntüleniyorÖzel bir sınıflandırma arşivi görüntüler. Kategoriler ve etiketler gibi, sınıflandırmaların da bir şeyleri sınıflandırmak için kullandığınız terimleri vardır. Örneğin: "Sanat" adlı bir sınıflandırma, "Modern" ve "18. Yüzyıl" gibi birden çok terim içerebilir. Bu şablon, daha duruma özgü bir şablon (Sınıflandırma: Sanat gibi) bulunamadığında alternatif olarak sunulur.Belirli bir tarihe gidildiğinde bir yazı arşivini görüntüler (ornek.com/2023/ gibi).Bir yazı kategorisi arşivini görüntüler. Bu şablon, daha duruma özgü bir şablon (Kategori: Tarifler gibi) bulunamadığında alternatif olarak sunulur.Bir yazı etiketi arşivini görüntüler. Bu şablon, daha duruma özgü bir şablon (Etiket: Pizza gibi) bulunamadığında alternatif olarak sunulur.Tek bir yazarın yazı arşivini görüntüler. Bu şablon, daha duruma özgü bir şablon (Yazar: Yönetici gibi) bulunamadığında alternatif olarak sunulur.Bu yazıya özel bir şablon uygulanmadığı ya da özel bir şablon var olmadığı sürece sitenizdeki tek bir yazıyı görüntüler.Özel bir şablon uygulanmadığı ya da özel bir şablon var olmadığı zaman sabit bir sayfa görüntüler.Ortam kitaplığından ya da Youtube, Vimeo ya da diğer hizmet sağlayıcılardan bir video görüntüler.Bir ses oynatıcı görüntüler.Bir görsel galerisi görüntüler.Bir görsel görüntüler.Tek bir yazarın yazıları, kategori, etiket, sınıflandırma, özel yazı türü ve tarih ile birlikte tüm arşivleri görüntüler. Bu şablon, daha duruma özgü şablonlar (Kategori ya da Etiket gibi) bulunamadığında alternatif olarak sunulur.Yazı ya da sayfa gibi herhangi bir tek kaydı görüntüler. Bu şablon, daha duruma özgü bir şablon (Tek yazı, Sayfa ya da Ek dosya gibi) bulunamadığında alternatif olarak sunulur.%s yazı biçimi arşivini görüntüler.Son yazıları site giriş sayfası ya da okuma ayarlarının altında tanımlanmış özel bir sayfa olarak görüntüler. Ön sayfa şablonu varsa, yazılar giriş sayfasında görüntülendiğinde, ön sayfa şablonu bu şablonu değiştirir.Bir ziyaretçi sitenizde arama yaptığında görüntülenir.Bir ziyaretçi hatalı bir bağlantı veya yanlış yazılmış bir adres gibi var olmayan bir sayfayı görüntülediğinde görüntülenir.Bir ziyaretçi herhangi bir ortam ek dosyası için var olan özel sayfayı görüntülediğinde görüntülenir.Sitenizin gizlilik ilkesi sayfasını görüntüler.Sitenizin giriş sayfasını, son yazılar ya da sabit bir sayfa ile görüntüler. Ön sayfa şablonu tüm şablonlara göre önceliklidir.Odaklanmayı sağlayan yazma kipiYönetim bölümünde %1$s betiğini kayıtlardan çıkarmayın. Ön yüz temasını hedeflemek için %2$s kancasını kullanın.%2$s içine %1$s gönderilmesin.Gerçekten <a href="%s">çıkış yapmak</a> istiyor musunuz?Belge <span class="count">(%s)</span>Belgeler <span class="count">(%s)</span>Belge ön izlemeBelge özellikleriBelgelerBelgeler%1$s kullanıcısının %2$s veri tabanına erişme izni var mı?BittiDosyayı indirDosyayı indirYeni tema indiriliyor&hellip;TaslakTaslak <span class="count">(%s)</span>Taslak <span class="count">(%s)</span>Taslak kaydedildiOrtam dosyalarını yeniden sıralamak için sürükleyip bırakın.Yardımcı kayıtların sıralamasını sürükleyip bırakarak değiştirebilirsiniz.Video sıralamasını değiştirmek için sürükle bırak.Yüklemek için dosyaları sürükleyip bırakınMavi ve turuncuMavi ve kırmızıKoyu gri tonlamaGri tonlamaMacenta ve sarıGece yarısıMor ve yeşilMor ve sarıYinelenen yorum ile karşılaşıldı. Bu yorumu daha önce yapmışsınız gibi görünüyor!HollandalıEXIF doğrultu değeri. 1-8 arası değerler EXIF teknik özelliklerine uygundur. 1, dödürülmeyecek anlamına gelir.Tüm yazı tipi src değerleri boş olmayan dizgeler olmalıdır.Tüm webfont src değerleri boş olmayan dizgeler olmalıdır.Düzenle%1$s ögesini düzenle (%2$s, %3$d / %4$d)%1$s ögesini düzenle (%2$s, %5$s altındaki %3$d / %4$d alt ögesi)%1$s ögesini düzenle (%2$s, %5$s altındaki %3$d / %4$d alt ögesi, %6$d. düzey)%1$s ögesini düzenle (%2$s, %5$s altındaki %3$d / %4$d alt ögesi, %6$s. düzey)Blok modelini düzenleKategoriyi düzenleDeğişim kümesini düzenleGörseli düzenleBağlantı kategorisini düzenleOrtamı düzenleMenüyü düzenleGezinme menüsünü düzenleÖzgünü düzenleSayfayı düzenleModel kategorisini düzenleYazıyı düzenleProfili düzenleSeçimi düzenleSiteyi düzenleEtiketi düzenleŞablonu düzenleŞablon parçalarını düzenleDüzenleKullanıcıyı düzenleSes oynatma listesini düzenleGaleriyi düzenleGörseli düzenleDiğer bilgileri düzenleSonraki ortam ögesini düzenleÖnceki ortam ögesini düzenleSeçilmiş menüyü düzenleŞablonu düzenleVideo oynatma listesini düzenleDüzenleyici menüsü (etkin olduğunda)Düzenleyici betik tanıtıcısı. KULLANIMDAN KALDIRILDI: Bunun yerine "editor_script_handles" kullanın.Düzenleyici betik tanıtıcıları.Düzenleyici biçem tanıtıcısı. KULLANIMDAN KALDIRILDI: Bunun yerine "editor_style_handles" kullanın.Düzenleyici biçem tanıtıcıları.Düzenleyici araç çubuğuBileşenlerin yoluE-postaYorum yazarının e-posta adresi.E-posta denetleme hızı %s ile sınırlıdır.E-posta&nbsp;adresi:E-posta: %sGömGömme işleyiciOrtam oynatıcısını göm%s gömüsü.Göm ya da bağlantı verGömülülerİfadelerTerim boş.Dosya adı boşBoş başlık.EtkinleştirKodlamaİngilizceBüyüt%1$s / %2$s genişletBüyütülmüş görselGenişletilmiş görsel %1$s / %2$sGenişletilmiş görsel %1$s / %2$s: %3$sBüyütülmüş görsel: %sBüyütülmüş görsellerSonuç kümesine belirli kullanıcı kimliklerinin yorumlarının katılmadığından emin olun. Kimlik doğrulaması gerekir.Sonuç kümesine belirli yazarlara atanmış yazıların katılmadığından emin olun.Sonuç kümesine belirli kimliklerin katılmadığından emin olun.Sonuç kümesine belirli üst öge kimliklerinin katılmadığından emin olun.Görsel için bir açıklama yazınBilgisayar ön izlemesi kipine geçMobil ön izlemesi kipine geçTablet ön izlemesi kipine geçRSS akışının adresini buraya yazın:Adresi yazınGörselin adresini yazınHedef adresi yazınAşağıya yeni parolanızı yazın ya da bir tane oluşturun.Yorumları görüntülemek için parolanızı yazın.Kayıt akışıHerhangi bir RSS ya da Atom akışındaki kayıtlar.Bağımlılıklar dizisindeki kayıtlar, kimlik anahtarı olan dizgeler ya da diziler olmalıdır.Kişisel verileri silHata ayrıntılarıYeni kullanıcı oluşturulurken sorun çıktı.Yazı tipi derlemesi JSON dosyası içeriklerinin kodu çözülürken sorun çıktı.HTTP yanıt JSON kodundaki yazı tipi derlemesi verilerinin kodu çözülürken sorun çıktı.Veri tabanı bağlantısı kurulurken sorun çıktı%1$s akışı alınırken sorun çıktı: %2$s"%s" üzerinden yazı tipi derlemesi verileri alınırken sorun çıktı.Ek dosya silinirken sorun çıktı.Sorun bir eklenti ya da temadan kaynaklanmamış.Korunmayan bir uç noktada sorun çıktı.Veri tabanı bağlantısı kurulurken sorun çıktı%1$s yolundaki JSON dosyasının şifresi çözülürken bir sorun çıktı: %2$sEstonyacaOlay zamanlaması bulunamadı.Olay zaman damgası geçerli bir Unix zaman damgası olmalıdır.ÖzetYazının özeti, veri tabanında olduğu gibi.Ayrı tut:Kurtarma kipinden çıkKurtarma kipinden çıkma bağlantısının süresi dolmuş.Arama alanını genişletBeklenen dizge, script kod imi ile (öznitelikler olmadan) başlamalı ve isteğe bağlı boşluk ile script kod imi ile bitmeli.BitişKişisel verileri dışa aktarJSON olarak dışa aktarUzantı eksik: Bileşen arayüzünde kenar çubuğuna atanacak ek CSS sınıfı.j F Yj F Y H:iF YBaşarısız olan <span class="count">(%s)</span>Başarısız olan <span class="count">(%s)</span>Sayfa silinemedi.Kurtarma kipinden çıkılamadı. Lütfen bir süre sonra yeniden deneyin.Hata kaydedilemedi.İstek geçici dosyaya yazılamadı.Bu tema tarafından desteklenen özellikler.ŞubatŞub%s kategorisi altındaki tüm yazıların akışıGeri bildirimŞu anda site haritalarında %s dışındaki alanlar desteklenmiyor.Şu anda site haritası dizini için %s dışındaki alanlar desteklenmiyor.%1$s dosyası, %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong> ve alternatifi yok.%1$s dosyası, %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong>. Bunun yerine %3$s kullanın.%1$s dosyası %2$s içinde kullanılmalıdır.%s dosyası bulunamadı!&#8220;%s&#8221; dosyası yok mu?&#8220;%s&#8221; dosyası bir görsel değil.Dosya hatası: Dosya açılamadı: Dosya adresi:Dosya iptal edildi.Dosya bulunamadı?Dosya bir görsel değil.Dosya adı:Dosya boyutu:Dosya türü:FilipinceEkranı doldur%s sonuç ögelerini ayrılmış adlar ile süz.Gezinme menüsü listesini süzKategoriye göre süzTarihe göre süzTüre göre süzOrtamları süzSayfa listesini süzModel listesini süzYazı listesini süzŞablon parçaları listesini süzŞablon listesini süzTemaları süzTemaları süz (%s)Bul ve değiştirİşletmenize nasıl yardımcı olabileceğimizi öğrenin.Finceİlk yazıKullanıcının adı.İlk sayfaEkrana sığdırSabit yerleşimÇevirBağımsız değişkenleri tersine çevir.Yönü tersine çevir.Türü tersine çevir.Akışkan yerleşimOdak kısayolları:Yazı tipi yüzüYazı tipi yüzleriYazı tipi aileleriYazı tipi ailesiYazı boyutu"%1$s" yazı tipi derlemesinin özelliği eksik ya da boş: "%2$s"."%s" yazı tipi derlemesi bulunamadı.Yazı derlemesi JSON dosyası geçersiz ya da bulunamadı.Yazı tipi derlemesi bulunamadı."%s" yazı derlemesi adres son eki geçersiz. Adres son eklerinde yalnızca harf, rakam, tire ve alt çizgi karakterleri kullanılabilir."%s" adres son ekini kullanan bir yazı derlemesi zaten kaydedilmiş.Yazı tipi yüzleri çöpe atılamaz. Silmek için "%s" olarak ayarlayın.Yazı tipi font-family değeri boş olmayan bir dizge olmalıdır.Yazı tipi font-weight değeri uygun şekilde biçimlendirilmiş bir dizge ya da tam sayı olmalıdır.Çok büyükBüyükOrtaKüçükYazı tipi src değeri boş olmayan bir dizge ya da dizge dizisi olmalıdır.Yazı tipleriDipnotlarFransızCumCumaCTam boyTam ekran%1$s işlevi, %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong> ve alternatifi yok.%1$s işlevi, %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong>. Bunun yerine %3$s kullanın.%1$s işlevi <strong>yanlış</strong> çağrıldı. %2$s %3$s%2$s sürümünden başlayarak bir değişken ile çağrılan %1$s işlevi <strong>kullanımdan kaldırıldı</strong> ve alternatifi yok.%2$s sürümünden başlayarak, bir parametre ile çağrılan %1$s işlevi <strong>kullanımdan kaldırıldı</strong>! %3$s%s işlevi PHP içinde yanlış kullanıldı.Yazının GUID değeri, veri tabanında olduğu gibi.Yazının görüntülenmek üzere dönüştürülmüş GUID değeri.Sürümün GUID değeri, veri tabanında olduğu gibi.GaliçyacaGaleriGaleri ayarlarıGenelGenel şablonlar çoğunlukla yazı içeriğini görüntülemek gibi belirli bir rolü yerine getirir ve belirli bir alana bağlı değildir.Parola oluşturTürAlmancaSaniyeler içinde <em>başka bir</em> %s sitesi edininOrtam bilgilerini alSiz de katılınYeni parola alSite bilgilerini alKullanıcı bilgilerini alBağlantılı nesneyi al.Bugün başlayın!Saniyeler içinde kendi %s hesabınızı açınBana bir site ver!Akış başlığını yazın (isteğe bağlı):Genel ayarlar.Temalara katılacak genel biçemler.Genel biçemler.Geri dönTema kaynaklarına gitNoto Serif:400,400i,700,700iKızıla çalan bordoKızıla çalan açık morSoğuktan sıcağa spektrumElektrikli çimAçık yeşilimsi maviden canlı yeşilimsi maviyeAydınlık alacakaranlıkParlak canlı kehribardan parlak canlı turuncuyaParlak canlı turuncudan canlı kırmızıyaGece yarısıSoluk okyanusÇok açık griden mavimsi griyeCanlı mavimsi yeşilden canlı moraGriYunancaYeşilMerhaba ağ yöneticisi!Izgara görünümüHTMLHTML gömmeEk dosyanın görüntülenmek üzere dönüştürülmüş HTML alt yazısı.Kullanıcıyı sorunu çözebilecekleri yerlere yönlendirme işleminin bulunduğu HTML.Yorumun görüntülenmek üzere dönüştürülmüş HTML içeriği.Yazının görüntülenmek üzere dönüştürülmüş HTML içeriği.Bu kenar çubuğuna atandığında her bir bileşenin çıktısının sonuna eklenecek HTML içeriği. Varsayılan değer liste ögesi kapatma kod imi.Görüntülendiğinde kenar çubuğu başlığının sonuna eklenecek HTML içeriği. Varsayılan değer h2 kapatma kod imi.Bu kenar çubuğuna atandığında her bir bileşenin çıktısının önüne eklenecek HTML içeriği. Varsayılan değer liste ögesi açma kod imi.Görüntülendiğinde kenar çubuğun başlığının başına eklenecek HTML içeriği. Varsayılan değer h2 açma kod imi.Ek dosyanın görüntülenmek üzere dönüştürülmüş HTML açıklaması.Terimin HTML açıklaması.Satır içiYazının görüntülenmek üzere dönüştürülmüş HTML özeti.Tema geliştiricisinin görüntülenmek üzere dönüştürülmüş HTML metni.Bileşenin yönetici formu için HTML gösterimi.Bileşenin HTML gösterimi.AdresDivPreÖnceden biçimlenmişNesnenin görüntülenmek üzere dönüştürülmüş HTML başlığı.Yazının görüntülenmek üzere dönüştürülmüş HTML başlığı.Şablonun görüntülenmek üzere dönüştürülmüş HTML başlığı.Terim için HTML başlığı.HTTP yeniden yönlendirme durum kodu, 3xx gibi bir yeniden yönlendirme kodu olmalıdır.HTTPS isteği yerine getirilemedi.Haiti kreyoluE-posta adresinizi doğru yazdığınıza emin misiniz? Siz %s yazmışsınız. E-posta adresinizi yanlış yazdıysanız gönderilen e-postayı alamazsınız.Üst bilgi görseliÜst bilgi ortamıÜst bilgi yazı rengiÜst bilgi videosuBaşlık hücresiBaşlık 1Başlık 2Başlık 3Başlık 4Başlık 5Başlık 6İbraniceYükseklikGörsel yüksekliğinin yüzdesi olarak kırpmanın yüksekliği.YardımMerhaba, görünüşe göre HTML'yi metin gerecinin &#8220;Görsel&#8221; sekmesine yapıştırmışsınız. Kodunuzu bunun yerine &#8220;Kod&#8221; sekmesine yapıştırmak isteyebilirsiniz. Alternatif olarak, yeni &#8220;Özel HTML&#8221; gerecini deneyin!Merhaba ###USERNAME###,

Bu bildirim, ###SITENAME### adresindeki e-posta adresinizin ###NEW_EMAIL### olarak değiştirildiğini doğrulamak için gönderilmiştir.

E-posta adresinizi siz değiştirmediyseniz ###ADMIN_EMAIL### adresinden yönetici ile görüşebilirsiniz.

Bu e-posta ###EMAIL### adresine gönderilmiştir.

Saygılarımızla,
###SITENAME### ekibi
###SITEURL###Merhaba ###USERNAME###,

Bu ileti ###SITENAME### sitesinde parolanızın değiştiğini bildirmek için gönderilmiştir.

Parolanızı siz değiştirmediyseniz, aşağıdaki adresten yönetici ile görüşebilirsiniz
###ADMIN_EMAIL###

Bu e-posta ###EMAIL### adresine gönderilmiştir.

Saygılarımızla,
###SITENAME### ekibi
###SITEURL###Merhaba,

Bu bildirim ###SITENAME### sitesindeki yönetici e-posta adresinin değiştiğini doğrulamak için gönderilmiştir.

Yeni e-posta adresi ###NEW_EMAIL###.

Bu e-posta ###OLD_EMAIL### adresine gönderilmiştir.

Saygılarımızla,
###SITENAME### ekibi
###SITEURL###Merhaba,

Bu bildirim ###SITENAME### sitesi için ağ yöneticisi e-posta adresinin değiştiğini onaylar.

Yeni ağ yöneticisi e-posta adresi ###NEW_EMAIL###.

Bu e-posta ###OLD_EMAIL### adresine gönderilmiştir

Saygılar,
###SITENAME###
###SITEURL###GizleÜst bilgi görselini gizleGörseli gizleParolayı gizleHintçeİpucu: Parola en az on iki karakter uzunluğunda olmalıdır. Daha güçlü olması için büyük harf, küçük harf, rakamlar ve ! " ? $ % ^ &amp; ) gibi simgeler kullanabilirsiniz.GirişGiriş sayfasıGiriş sayfası ayarlarıGiriş sayfası ve yazılar sayfası farklı olmalı.%1$s kancası %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong> ve şu an için alternatifi yok.%1$s kancası %2$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong>! Yerine %3$s kullanın.Yatay çizgiKırpmaya, görsel genişliğinin bir yüzdesi olarak başlamak için soldan yatay konum.Yatay boşlukSaatKaç ögenin görüntülenmesini istiyorsunuz?Arama girdisinin nasıl yorumlanacağı.Merhaba ###USERNAME###,

Kısa bir süre önce hesabınıza bağlı e-posta adresinin değiştirilmesi istendi.

Bu işlemi siz yaptıysanız aşağıdaki bağlantıya tıklayarak ilerleyin.
###ADMIN_URL###

Bu işlemi siz yapmadıysanız, güvenle bu e-postayı yok sayabilir ya da silebilirsiniz.

Bu e-posta ###EMAIL### adresine gönderilmiştir

Saygılarımızla,
###SITENAME### ekibi
###SITEURL###Merhaba ###USERNAME###,

Kısa bir süre önce ağınızdaki ağ yöneticisi e-posta adresinin değiştirilmesi istendi.

Bu işlemi siz yaptıysanız lütfen aşağıdaki bağlantıya tıklayarak değişikliği tamamlayın:
###ADMIN_URL###

Bu işlemi siz yapmadıysanız bu e-postayı gönül rahatlığıyla yok sayabilirsiniz.

Bu e-posta ###EMAIL### adresine gönderilmiştir.

Saygılarımızla,
###SITENAME### ekibi
###SITEURL###Merhaba USERNAME,

SITE_NAME siteniz kuruldu, adresi:
BLOG_URL

Aşağıdaki bilgiler ile yönetim bölümünde oturum açabilirsiniz:

Kullanıcı adı: USERNAME
Parola: PASSWORD
Oturum açma adresi: BLOG_URLwp-login.php

Yeni sitenizi seveceğinizi umuyoruz. Teşekkürler!

--SITE_NAME ekibiMerhaba USERNAME,

Yeni hesabınız oluşturuldu.

Aşağıdaki bilgiler ile oturum açabilirsiniz:
Kullanıcı adı: USERNAME
Parola: PASSWORD
LOGINLINK

Teşekkürler

--SITE_NAME ekibiMerhaba!

WordPress yönetim bölümünde, bir eklenti veya tema sitenizde ciddi bir soruna neden olduğunda bunu algılayan ve sizi bu otomatik e-posta ile bilgilendiren bir özellik bulunur.
###CAUSE###
İlk olarak, sitenize gidin (###SITEURL###) ve görünür herhangi bir sorun olup olmadığına bakın. Ardından, hatanın bulunduğu sayfayı (###PAGEURL###) açın ve görünür herhangi bir sorun olup olmadığına bakın.

###SUPPORT###

Siteniz bozuk görünüyorsa ve yönetim bölümüne normal şekilde erişemiyorsanız, artık özel bir WordPress "kurtarma kipi" var. Bunu kullanarak, yönetim panonuzda güvenli bir şekilde oturum açarak başka araştırmalar yapabilirsiniz.

###LINK###

Sitenizi güvende tutmak için bu bağlantının süresi ###EXPIRES### içinde dolacak. Yine de bu konuda endişelenmeyin. Süresi dolduktan sonra sorun yeniden çıkarsa size e-posta ile yeni bir bağlantı gönderilir.

Bu sorunla ilgili yardım ararken, aşağıdaki bilgilerden bazıları istenebilir:
###DEBUG###

###DETAILS###Merhaba,

Hesabınız için aşağıdaki işlemin yapılması isteğinde bulunuldu: 

     ###DESCRIPTION###

İşlemi onaylamak için lütfen aşağıdaki bağlantıya tıklayın:
###CONFIRM_URL###

İşlemin yapılmasını istemiyorsanız, bu e-postayı güvenli bir şekilde yok sayabilir ve silebilirsiniz.

Saygılarımızla,
###SITENAME###
###SITEURL###Merhaba,

###SITENAME### sitesindeki kullanıcı kişisel verileri gizlilik isteği onaylandı:

Kullanıcı: ###USER_EMAIL###
İstek: ###DESCRIPTION###

Kişisel verilerle ilgili istekleri buradan görebilir ve yönetebilirsiniz:

###MANAGE_URL###

Saygılarımızla,
###SITENAME### ekibi
###SITEURL###Merhaba,

###SITENAME### sitesindeki kişisel verilerinizi silme isteğiniz yerine getirildi.

Bu konuyla ilgili herhangi bir sorunuz veya endişeniz varsa lütfen site yöneticisi ile görüşün.

Ayrıntılı bilgi almak için gizlilik ilkemizi de okuyabilirsiniz: ###PRIVACY_POLICY_URL###

Saygılarımızla,
###SITENAME###
###SITEURL###Merhaba,

###SITENAME### sitesindeki kişisel verilerinizi silme isteğiniz yerine getirildi.

Bu konuyla ilgili herhangi bir sorunuz veya endişeniz varsa lütfen site yöneticisiyle görüşün.

Saygılarımızla,
###SITENAME###
###SITEURL###Merhaba, %sAncak yine de <a href="%s">bu temayı etkinleştirebilir</a> ve özelleştirmek için site düzenleyicisini kullanabilirsiniz.Yazarın insan tarafından okunabilen metni.Çeşitli bağlamlardaki yazı türleri için insan tarafından okunabilen etiketler.Çeşitli bağlamlardaki sınıflandırmalar için insan tarafından okunabilen etiketler.Bileşen türünü ayırt etmek için kullanılan insan tarafından okunabilen ad.MacarcaYaşasın! Temanız bloklarla site düzenlemeyi destekliyor. <a href="%1$s">Ayrıntılı bilgi alın</a>. %2$sBunu yapabilmek için gerçekten bir kimlik gerekiyor.Genel biçem yapılandırmasının kimliği.Kenar çubuğunun kimliği.Şablonun kimliği.Yazı bağlamının kimliği.IE koşullu yorumları, desteklenen tüm tarayıcılar tarafından yok sayılır.Dosya okuma/yazma sorunu.IPYorum yazarının IP adresi.İzlandacaSimgeSimge içeriğinde geçerli SVG işaretlemesi yok.Simge içeriği bir dizge olmalıdır.Simge etiketi bir dizge olmalıdır.Simge adı bir dizge olmalıdır.Simge adı.Simge bulunamadı: “%s”.Blok türünün simgesi.Simgelerde ‎`content` veya ‎`filePath` bulunmalıdır.KimlikKimlik bir harfle başlamalı ve harf, rakam, tire, nokta, iki nokta üstüste veya alt çizgi karakterleri ile sürmeli.Değer bir dizge ise, değer arşiv adres son eki olarak kullanılır. Değer 'false' ise, yazı türünün arşivi yoktur.Bu e-postayı yanlışlıkla aldıysanız yok sayabilirsiniz. Herhangi bir sonucu olmaz.Bir video eklerseniz, görsel video yüklenirken kullanılır.Microsoft Word üzerinden zengin içerik yapıştırmak istiyorsanız, bu seçeneği kapatmayı deneyin. Düzenleyici Word üzerinden yapıştırılan metni otomatik olarak düzeltir.Gerçekten harika bir etki alanı kullanmayacaksanız yeni bir kullanıcıya bırakın! Şimdi başlayın!Bu iletiye takılıp kaldıysanız veri tabanınızda şu tabloların bulunduğundan emin olun:Bu ağın sahibiyseniz, lütfen sunucunuzdaki veri tabanı sunucusunun düzgün çalıştığını ve tüm tabloların hatasız olduğunu kontrol edin.Bu terimlerin ne anlama geldiğini bilmiyorsanız hizmet sağlayıcınız ile görüşmelisiniz. Yine de yardıma gerek duyuyorsanız <a href="%s">WordPress destek forumları</a> üzerinden yardım alabilirsiniz.İki gün içinde sitenizi etkinleştirmezseniz, yeniden hesap açmanız gerekecek.Kullanıcı adınızı iki gün içinde etkinleştirmezseniz, yeniden hesap açmanız gerekecek.Bir veri tabanını nasıl kuracağınızı bilmiyorsanız <strong>hizmet sağlayıcınızla görüşmelisiniz</strong>. Sonuç alamazsanız <a href="%s">WordPress destek forumları</a> üzerinden yardım alabilirsiniz.Hala e-posta iletisini almadıysanız, yapabileceğiniz birkaç şey var:Siteniz görüntülenmiyorsa lütfen bu ağın sahibi ile görüşün.Temanızda birden fazla menü varsa, onlara anlaşılır adlar vermek yönetmenize yardımcı olur.Temanızın bileşen alanları varsa oralara da menüler ekleyebilirsiniz. <a href="%s">Bileşenler panosu</a> bölümüne gidip &#8220;Gezinme menüsü bileşenini&#8221; ekleyerek kenar çubuğunda ya da alt bilgide bir menü görüntülenmesini sağlayabilirsiniz.GörselGörsel <span class="count">(%s)</span>Görsel <span class="count">(%s)</span>Görsel CSS sınıfıGörsel düzenleyici kaydedemediGörsel konumuGörsel boyutuGörsel başlığı özniteliğiGörsel adresiGörsel bileşeniGörsel bileşeni (%d)Görsel bileşeni (%d)Görsel kırpma alanı ön izleme. Fare ile işlem yapılması gerekir.Görsel kırpılamadı.Varsayılan görsel hizalamasıVarsayılan görsel bağlantısı türüVarsayılan görsel boyutuGörsel açıklamasıGörsel bilgileriGörsel düzenleme.Görsel çevrilemedi.Görsel boyutu değiştirilemedi.Görsel döndürülemedi.Piksel cinsinden görsel boyutuGörseller%1$s için %2$s yöntemini kullanın, %3$s işlevini kullanmayın. %4$s adresine bakın.%s yorumuna yanıt olarak.%s için yanıtDüzenleme alanında, sekme tuşu bir sekme karakteri yazar.Bu durumda, WordPress eklentilerinizden birinde bir sorun buldu, %s.Bu durumda, WordPress temanızda bir sorun buldu, %s.Etkin olmayan bileşenlerYazı parolası yanlış.Geçersiz kullanıcı adı ya da parola.Girintiyi artırBir şablonun özel mi yoksa şablon hiyerarşisinin bir parçası mı olduğunu gösterirGeçerli değişimin varsayılan olup olmadığını gösterir.EndonezyacaVar olmayan terimler.Biçem için gereken CSS sınıfını kaydeden satır içi CSS kodu.Satır arası araç çubuğu (bir görsel, bağlantı ya da ön izleme seçilmişken)Yetenek yürütme için giriş parametreleri.Sayfa sonu kod imi ekleDevamını oku kod imi ekleSes oynatma listesi ekleArdına sütun ekleÖnüne sütun ekleTarih/zaman ekleAdresten ekleGaleri ekleGörsel ekleGezinme menüsüne ekleSayfaya ekleYazıya ekleŞablona ekleŞablon parçasına ekleBağlantı ekleArdına satır ekleÖnüne satır ekleTablo ekleVideo ekleVideo listesini ekleKod örneği ekle/düzenleGörsel ekle/düzenleBağlantı ekle/düzenleOrtam ekle/düzenleEklenen metinKurKur ve ön izleTemayı kur ve ön izle: %sGoogle Fonts üzerinden kurun. Yazı tipleri sitenize kopyalanır ve oradan sunulur.Kurulu temalarBileşen kopya ayarları, destekleniyorsa.Bu XML-RPC yöntemine aktarılan değişkenler yetersiz.Uyumsuz bir %1$s etiketi içinde etkileşim yönergeleri bulundu. Bu yönergeler sayfa sunucu tarafında oluşturulurken yok sayılacak."%2$s" işlenirken uyumsuz bir %1$s etiketinde etkileşim yönergeleri bulundu. Bu yönergeler sayfa sunucu tarafında oluşturulurken yok sayılacak.İç arama işleyici sorunu.Kendinizi tanıtın.GeçersizBelirtilen Content-Disposition geçersiz. Content-Disposition `attachment; filename="gorsel.png"` biçiminde olmalıdır.Aktarılan JSON gövdesi  geçersiz.JSONP geri çağırma işlevi geçersiz.Adres geçersiz%s adres kalıbı bağlamı geçersiz.Adres geçersiz.İşlem adı geçersiz.Etkinleştirme anahtarı geçersiz.Adres geçersiz: Bu XML-RPC yöntemine geçersiz bağımsız değişkenler aktarıldı. İki tam sayı gerekir.Ek dosya kimliği geçersiz.Öznitelik adı geçersiz.Yazar kimliği geçersiz.Blok türü geçersiz.Blok geçersiz.Değişim kümesi UUID geçersizYorum kimliği geçersiz.Yorum yazarı kimliği geçersiz.Yorum içeriği geçersiz.Yorum durumu geçersiz.Çerez biçimi geçersiz.Çerez geçersiz.Tarih geçersiz.E-posta adresi geçersiz.Öne çıkarılmış ortam kimliği geçersiz.Komut dosyası kaydı sırasında `%2$s` için tanımlanan geçersiz fetchpriority `%1$s`.Geçersiz fetchpriority: %sBaşlık adı veya değeri geçersizOnaltılık renk geçersiz.Sunucu kaydı geçersiz: Sunucu geçersiz: Simge özelliği geçersiz: “%s”.Öge kimliği geçersiz.Anahtar geçersiz.Menü kimliği geçersiz.Menü konumu geçersiz.Nesne kimliği geçersiz.Nesne türü geçersiz.Sayfa şablonu geçersiz.Parametreler geçersiz: %sParametre geçersiz.Parametreler geçersiz.Üst tür geçersiz.Geçersiz parola.Kişisel veri isteği geçersiz.Yazı kimliği geçersiz.Yazı biçimi geçersiz.Üst yazı kimliği geçersiz.Yazı türü geçersiz.Yazı geçersiz.Kurtarma anahtarı biçimi geçersiz.Kurtarma anahtarı geçersiz.İstek durumu geçersiz.Sürüm kimliği geçersiz.Rol geçersiz.%1$s kısa kod adı geçersiz. Boşluk karakteri ya da izin verilmeyen karakterleri kullanmayın: %2$sKısa kod adı geçersiz: Boş bir ad belirtilmiş.Adres son eki geçersiz.Durum geçersiz.Betik kaydı sırasında "%2$s" için geçersiz "%1$s" stratejisi tanımlandı.Sınıflandırma geçersiz.Sınıflandırma geçersiz: %s.Şablon üst öge kimliği geçersiz.Terim kimliği geçersiz.Terim adı geçersiz.Parametre türü geçersiz.Yeniden atanacak kullanıcı kimliği geçersiz.Kullanıcı kimliği geçersiz.Kullanıcı parametreleri geçersiz.%2$s için %1$s değeri geçersiz. Beklenen değer %3$s ile %4$s arasında olmalı.Arka plan ek dosyası değeri geçersiz.Arka plan X konumu değeri geçersiz.Arka plan Y konumu değeri geçersiz.Arka plan yinelemesi değeri geçersiz.Arka plan boyutu değeri geçersiz.Değer geçersiz.Bileşen türü geçersiz.İrlandacaBlok dinamik olarak mı oluşturuluyor.Bize hiç bağlantı veren yok mu?Sitenizin henüz herhangi bir menüsü yok gibi görünüyor. Bir menü oluşturmak ister misiniz? Başlamak için düğmeye basın.Burada bir şey bulunamadı. Belki de doğrudan %s adresine bakmalısınız?Yanıt bu siteden gelmemiş gibi görünüyor.İtalyancaEğikÖge eklendi.Ögeler silindi.Yetenek girdisi için JSON şeması.Yetenek çıktısı için JSON şeması.JSONP desteği bu sitede etkin değil.OcakOcaJaponcaGelecekte bu özelliğin kullanılabilmesi için JavaScript etkin olmalıdır.TemmuzTemDipnot başvurusuna atla %1$dHaziranHazYalnızca bir kullanıcı adı, lütfen.İki yana yaslaYazı tipi ailesi hazır ayarı için kebap-case eşsiz belirteci.Bileşen ayarlarını koru ve etkin olmayan bileşenlere taşıKlavye kısayollarıAnahtar sözcükAnahtar sözcüklerKoreceDilBüyükBüyük boyut görsel yüksekliğiBüyük boyutta görsel genişliğiSon oturum açmaSon değiştirilmeSon yazıKullanıcının soyadı.Son sayfaSon güncellenmeSon güncellenme: %sEnlemLetoncaYerleşimWordPress öğreninAyrıntılı bilgi alınCSS ile ilgili ayrıntılı bilgi alınSite haritaları ile ilgili ayrıntılı bilgi alın.WordPress sorunlarını gidermek ile ilgili ayrıntılı bilgi alın.Yorum yapınBir yanıt yazın%s için bir yanıt yazınSolSüre:HarfYanıtı belirli bir ISO8601 uyumlu tarihten sonra yayınlanmış yorumlarla sınırlandırır.Yanıtı belirli bir ISO8601 uyumlu tarihinden önce yayınlanmış yorumlarla sınırlandırır.Yanıtı belirtilen ISO8601 uyumlu tarihten sonra değiştirilmiş yazılarla sınırlandırır.Yanıtı belirtilen ISO8601 uyumlu tarihten önce değiştirilen yazılarla sınırlandırır.Yanıtı belirtilen bir ISO8601 uyumlu tarihten sonra yayınlamış yazılarla sınırlandırır.Yanıtı ISO8601 uyumlu tarihten önce yayınlanmış kaynaklarla sınırlandırır.Sonuç kümesini birkaç sınıflandırma ile arasındaki ilişkiyle sınırlandırır.Sonuç kümesini belirli bir üst kimliği taşımayan tüm ögelerle sınırlandırır.Sonuç kümesini belirli bir MIME türü veya MIME türlerinin ekleriyle sınırlandırır.Sonuç kümesini belirli bir ortam türü veya ortam türlerinin ekleriyle sınırlandırır.Sonuç kümesini, arama terimiyle eşleşen bloklarla sınırlandırır.Sonuç kümesini belirli durumlar atanmış yorumlarla sınırlandırır. Kimlik doğrulaması gerekir.Sonuç kümesini belirli bir türe atanmış yorumlarla sınırlandırır. Kimlik doğrulaması gerekir.Sonuç kümesini belirli yazı kimliklerinin yorumları ile sınırlandırır.Sonuç kümesini belirli kullanıcı kimliklerinin yorumları ile sınırlandırır. Kimlik doğrulaması gerekir.Sonuç kümesini belirli üst öge kimliklerini taşıyan yorumlarla sınırlandırır.Sonuç kümesini, verilen bir veya daha fazla biçime atanmış ögelerle sınırlayın.Sonuç kümesini %s sınıflandırmasına atanmış belirli terimler dışında tüm ögelerle sınırlandırır.Sonuç kümesini sabit ögelerle sınırlandırır.Sonuç kümesini belirli üst kimlikleri taşıyan ögelerle sınırlandırır.Sonuç kümesini %s sınıflandırmasına atanmış belirli terimler geçen ögelerle sınırlandırır.Sonuç kümesini bir ya da birkaç durum atanmış yazılarla sınırlandırır.Sonuç kümesini belirli yazarlara atanmış yazılarla sınırlandırır.Sonuç kümesini belirli bir menu_order değerini taşıyan yazılarla sınırlandırır.Sonuç kümesini belirli bir ya da birkaç yazı adres son eki ile sınırlandırır.Sonuç kümesini belirli kimliklerle sınırlandırır.Sonuç kümesini belirli bir üst terime atanmış terimlerle sınırlandırır.Sonuç kümesini belirli bir yazıya atanmış terimlerle sınırlandırır.Sonuç kümesini belirli bir ya da birkaç terim adres son eki ile sınırlandırır.Sonuç kümesini belirli yazar e-posta adresleriyle sınırlandırır. Kimlik doğrulaması gerekir.Sonuç kümesini bir ya da birkaç durum atanmış temayla sınırlandırır.Sonuç kümesini, belirtilen yetkinliklerden en az biri ile eşleşen kullanıcılarla sınırlandırır. Virgül ile ayrılmış yetkinlikler ya da tek bir yetkinlik kabul edilebilir.Sonuç kümesini belirtilen belirli rollerden en az birine uyan kullanıcılara sınırlandırır. Virgül ile ayrılmış roller ya da tek bir rol kabul edilir.Sonuç kümesini yazar olarak kabul edilen kullanıcılarla sınırlandırır.Sonuç kümesini yazı yayınlayan kullanıcılarla sınırlandırır.Sonuç kümesini belirli bir ya da birkaç kullanıcı adres son eki ile sınırlandırır.Sonuçları belirli yetenek kategorilerindeki yeteneklerle sınırlandırır.Sonucu, bir nesne türünün ögeleriyle sınırlandırır.Sonucu bir ya da birkaç nesne alt türünün ögeleriyle sınırlandırır.Sonuç kümesini belirli bir yazı türü ile ilişkilendirilmiş sınıflandırmalarla sınırlandırır.Sonuçları bir kategori kimliğiyle eşleşenler ile sınırlandırır.Sonuçları bir anahtar sözcük kimliğiyle eşleşenler ile sınırlandırır.Sonuçları bir modelle (adres son eki) eşleşenlerle sınırlandırır.Kayıt kümesini bir dizge ile eşleşecek şekilde sınırlandırır.Belirli bir yazı kimliği ile sınırlandırır.Belirtilmiş şablon parçası alanı ile sınırlandırır.Sonuçları, belirtilen durumdaki eklentilerle sınırlandırır.BağlantıCSS sınıfına bağlantı verBağlantı kategorileriBağlantı kategorisiBağlantı kimliğiBağlantı için RelBağlantı İlişkisi (XFN)Bağlantı metniŞuna bağlantıBağlantıBağlantılarBağlantı eklendi.Bağlantı seçenekleriBağlantı değerlendirmesiBağlantı seçildi.Bağlantı başlığıEk dosya sayfasına bağlantıOrtam dosyasına bağlantıBağlantı:Bağlantılar%s için bağlantılarRastgeleListe maddesiKullanılabilecek yazı tipi ağırlıklarının bir boşluk ile ayrılmış listesi.Ekli dosyanın kayıp görsel boyutlarının listesi.Liste görünümüLitvancaCanlı yayınCanlı ön izlemeCanlı ön izleme: %sCanlı tema ön izlemesi: %sYüklenmiş sürüm '%1$s' beklenen sürüm '%2$s' ile uyumsuz.Daha fazla sonuç yükleniyor... lütfen bekleyin.Sayfa yükleniyor, lütfen bekleyin.Kullanıcının dil ayarı.Oturum açÇıkış yapOturum açYanıtlamak için oturum açınYorum yapmak için oturum açınÇıkış%1$s olarak oturum açılmış. <a href="%2$s">Profilinizi düzenleyin</a>. <a href="%3$s">Oturum kapatılsın mı?</a>Oturum açma adresi (URL)Kullanıcının oturum açma adı.Oturum açma, RSS ve WordPress.org bağlantıları.LogoBoylamBir tema mı arıyorsunuz? WordPress.org tema dizinine göz atabilir veya arama yapabilirsiniz. Temaları kurabilir ve ön izleyebilirsiniz. Ardından bunları hemen buradan etkinleştirebilirsiniz.Bir sorun çıktı gibi görünüyor. Birkaç saniye bekleyin ve sonra yeniden deneyin.Bu dosya doğru türde değil gibi görünüyor. Lütfen bunun yerine uygun bir dosyayı bağlayın.Bu dosya doğru türde değil gibi görünüyor. Lütfen bunun yerine uygun bir ses dosyası bağlayın.DöngüParolamı unuttumParolanızı mı unuttunuz?j M Y H:iMakedonyacaBakımMalayacaMalta DiliArşivleri yönetSes dosyalarını yönetYorumları yönetBelgeleri yönetGörselleri yönetSite yönetimiHesap tablolarını yönetVideoları yönetEl ile farklarMartMarBüyük küçük harf duyarlıTerimleri belirtilen kimliklerle eşleştir.Matt MullenwegSonuç kümesinde döndürülecek en fazla öge sayısı.Bir sayfadaki en fazla yazı sayısıYüklenebilecek en büyük dosya boyutu: %s.MayısMayOrtamlarOrtam dosyasıOrtam kitaplığıOrtam bileşeniOrtam bileşeni (%d)Ortam bileşeni (%d)HiçbiriOrtam listesiOrtam başlığıOrtam başlığı&hellip;OrtaOrta büyüklükte görsel yüksekliğiOrta boyut görsel genişliğiOrta-büyük boyut görsel yüksekliğiOrta-büyük boyut görsel genişliğiBellek sınırı aşıldı. Lütfen daha küçük bir dosya deneyin.MenüMenü ögesiMenü konumuMenü konumlarıMenü adıMenü seçenekleriMenü oluşturulduMenü silindiMenü elemanı eklendiMenü elemanı silindiMenü ögesi artık bir alt ögeMenü elemanı aşağı taşındıMenü elemanı alt menünün dışına taşındıMenü elemanı yukarı taşındıMenü ögeleri çöpe atılamaz. Silmek için '%s' olarak ayarlayın.MenülerMenüler temanızda belirlenen konumlarda ya da &#8220;Gezinme menüsü&#8221; bileşeni ile <a href="%s">bileşen alanlarında</a> görüntülenebilir.Menüler temanızda belirlenen alanlarda görüntülenir.Menüler çöpe atılamaz. Silmek için '%s' olarak ayarlayın.Tablo hücrelerini birleştirMeridyenMesaj gövdesi boşÜst veriÜst veri alanları.Yetenek ile ilgili üst bilgiler.Kategori ile ilgili üst bilgiler.Nesne alt türü sürümleri desteklemiyorsa, üst veri anahtarları ile sürümler etkinleştirilemez.Nesne türü sürümleri desteklemiyorsa, üst veri anahtarları ile sürümler etkinleştirilemez.Üst veriler%1$s yöntemi %2$s üzerinde yok.'%s' yöntemi değiştirilmelidir.'%s' yöntemi uygulanmamış. Alt sınıfta değiştirilmelidir.OrtaGereken en düşük PHP sürümü.Gereken en düşük WordPress sürümü.DakikaEk dosya eksikEksik onay anahtarı.(adsız)Eksik parametre(ler): %sİstek kimliği eksik.Bağımlılıklar dizisi içindeki kayıtta gerekli kimlik anahtarı eksik.Önceden hesaplanmış WP_Token_Map için gerekli girişler eksik.Görev tamamlandı. %s iletisi silindi.PtsPazartesiPAyAşağı indirBir alta taşıBir alttaki düzeye taşıBir üstteki düzeye taşı%s altından çıkarÇöpe atBaşka bir alana taşı&hellip;En üste taşı%s altına taşıYukarı çıkarBir üste taşıTaşıDaha karmaşık yerleşimlerdeki çok sütunlu modeller.En az dört karakter uzunluğunda, yalnızca harfler ve rakamlardan oluşmalıdır. Daha sonra değiştirilemeyeceği için dikkatli seçin!SessizSitelerimAdKodGörselAdYazı tipi ailesi hazır ayarının adı, çevrilebilir.Ad alanı eğik çizgiyle başlamamalı veya bitmemelidir. Bunun yerine, '%2$s' rotası için '%1$s' ad alanı bir eğik çizgi içeriyor gibi görünüyor.Adlandırma alanı veya başvuru yolu boş olamaz. Başvurulan yönerge değeri: %sGezinme menüsü konumları dizgeler olmalıdır.GezinmeGezinme etiketiGezinme menüsüGezinme menüsü ögesiGezinme menüsü ögeleriGezinme menüsü arşivleriGezinme menüsü güncellendi.Gezinme menüleriGezinme menüleri listesiGezinme menüsü listesi gezinmesiGezinme kaplamasıSitenize eklenebilecek gezinme menüleri.Daha fazla yardım mı gerekiyor? <a href="%1$s"> %2$s üzerindeki destek yazısını okuyun</a>.İç içe yerleştirilmiş bileşenler.Ağ yöneticisiAğ yöneticisi: %s%2$s adresine %1$s isteği gönderilirken ağ sorunu çıktı: %3$s%1$s adresine istek gönderilirken ağ sorunu çıktı: %2$sYalnızca ağ eklentisi tüm ağda etkinleştirilmelidir.Yeni %1$s site: %2$sYeni %1$s Kullanıcı: %2$sYeni kategori adıYeni değişim kümesiYeni özel HTML bileşeniYeni bağlantı kategorisi adıYeni menüGezinme menüsü ekleYeni sayfaYeni modelYeni model kategorisi adıYeni YazıYeni site kaydı: %sYeni site: %1$s
Adres: %2$s
IP adresi: %3$s

Bu bildirimler gönderilmesin: %4$sYeni etiket adıYeni şablonYeni şablon parçasıYeni kullanıcı hesabı açma: %sYeni kullanıcı: %1$s
Uzak IP adresi: %2$s

Bu bildirimleri kapat: %3$s"%s" yazınızda yeni yorumYeni belge"%s" yazınıza yeni notYeni sayfa başlığıYeni parola"%s" yazınızda yeni geri bağlantı%1$s tarafından yeni site oluşturuldu

Adres: %2$s
Ad: %3$s[%1$s] %2$s sitesini etkinleştir"%s" yazınızda yeni geri izleme[%1$s] %2$s hesabını etkinleştir%s sitenizde yeni kullanıcı hesabı açıldı:Yeni sürüm yayınlanmış.Yeni sürüm yayınlanmış. %sYeni pencereYeni yorumlarYeni yorumlar &raquo;Daha yeni yorumlarDaha yeni yazılarSonrakiSonraki &gt;Sonraki &raquo;Sonraki sayfaSonraki sayfa &raquo;Sonraki yazıSonraki sayfaGüzel ad 50 karakterden uzun olmamalı.Hayır"%2$s" kenar çubuğu için %1$s parametre dizisi belirtilmemiş. "%3$s" varsayılanına dönülüyor. %1$s değerlerini kendiniz "%3$s" olarak düzenleyip, bu iletiyi gizleyebilir ve var olan kenar çubuğunun içeriğini koruyabilirsiniz.Klasik menü bulunamadı.Yorum yapılmamışYorum yok<span class="screen-reader-text"> %s</span>Content-Disposition belirtilmemiş.Content_Type belirtilmemiş.Çöpte herhangi bir gezinme menüsü bulunamadı.Herhangi bir gezinme menüsü bulunamadı.Hizalama yokGörüntülenecek bir arşiv yok.Herhangi bir ses dosyası seçilmemişKategori yokKategori bulunamadı.Henüz herhangi bir değişiklik kaydedilmemiş. Yani çöpe atılacak bir şey yok.Devralınacak bir değişiklik kümesi yokÇöpte herhangi bir değişim kümesi bulunamadı.Değişim kümesi bulunamadı.Renk yokYorum yapılmamışGörüntülenecek bir yorum yok.<span class="screen-reader-text">%s için </span>Hiç yorum yokÇerez yok.Herhangi bir veri sağlanmadı.Hiç bir düzenleyici seçilemedi.Yedek menü bulunamadı.Dosya seçilmediBu kimlikle bir genel biçem yapılandırması bulunamadı.Herhangi bir görsel seçilmemişHerhangi bir görsel seçilmemişEleman yokHerhangi bir öge bulunamadı.Herhangi bir logo seçilmemişEşleşen şablon bulunamadıEşleşen şablon bulunamadı.Herhangi bir ortam ögesi bulunamadı.Herhangi bir ortam ögesi bulunamadı. Başka şekilde aramayı deneyin.Herhangi bir ortam seçilmemişHenüz herhangi bir menü oluşturulmamış. <a href="%s">Bir tane oluşturun</a>.Çöpte herhangi bir sayfa yok.Sayfa bulunamadı.Herhangi bir model kategorisi yokHerhangi bir model kategorisi bulunamadı.Çöpte herhangi bir model yok.Model bulunamadı.Herhangi bir eklenti belirtilmemiş.Çöpte herhangi bir yazı yok.Yazı bulunamadı veya yazılar alınırken bir sorun çıktı.Hiç yazı bulunamadı.Belirtilen yol için kaydedilmiş bir blok üst verileri derlemesi bulunamadı.Herhangi bir sonuç bulunamadı.İstek yöntemi ve bağlantıyla eşleşen yol bulunamadı.Arama ifadesi belirtilmemiş. Son ifadeler görüntüleniyor.Bu kodu kullanan bir kenar çubuğu yok.Etiket yokEtiket bulunamadı.Çöpte herhangi bir şablon parçası bulunamadı.Herhangi bir şablon parçası bulunamadı.Bu kimlikle bir şablon bulunamadı.Çöpte herhangi bir şablon bulunamadı.Şablon bulunamadı.Bu şablon için herhangi bir tema tanımlanmamış.Tema bulunamadı. Farklı bir arama yapmayı deneyin ya da %s.Tema bulunamadı. Farklı bir arama deneyin.Geçerli bir bağlam bileşeni bulunamadı.Herhangi bir video seçilmemişBu kodla bir bileşen bulunamadı.Hiçbir bileşen bulunamadı.Kimlik için boş olmayan bir dizge gereklidir.Var olmayan değişim kümesi UUID.Kesintisiz boşlukHiçbiriNorveçceBir yetenek işlev çağrısı değilKullanılamıyorBu kullanıcıyı oluşturmak için yeterli veri bulunmuyor.Yükleme için yeterli alan yok. %s KB alan gerekli.Bulunamadı: %1$s (%2$s)Not çözülme durumuNot: %sBildirimlerKasımKasBu XML site haritasındaki site adresi sayısı: %s.Görüntülenecek yorum sayısı:Bulunan öge sayısı: %dGörüntülenecek bağlantı sayısı:Bulunan ortam ögesi sayısı: %dGörüntülenecek yazı sayısı:Terim ile yayınlanmış yazı sayısı.%d bileşen bulunduNumaralı listeTamamNesne kimliği bir sayı olmalıdır, %s belirtilmiş.Nesne alt türü.Nesne türü.EkimEkiSonuç kümesini belirli sayıda öge kadar kaydırır.Eski yorumlarDaha eski yorumlarDaha eski yazılarBazı sistemlerde veri tabanı adlarına ön eki olarak kullanıcı adı eklenir. Durum buysa <code>username_%1$s</code> olabilir. Sorun bu olabilir mi?Günde bir kezSaatte bir kezHaftada birBir ya da birkaç veri tabanı tablosu kötü durumda. Veri tabanının <a href="%s">onarılması</a> gerekiyor olabilir.Bir yanıt%s için bir yanıt&#8220;%s&#8221; için bir yanıtYalnızca %1$s ya da %2$s dosyaları üst bilgi videosu için kullanılabilir. Lütfen video dosyanızın biçimini değiştirerek yeniden deneyin ya da videoyu YouTube üzerine yükleyerek aşağıdaki seçenekten bağlayın.Şu an için yalnızca UUID V4 destekleniyor.Bir kaldırma kancasında yalnızca statik sınıf yöntemi ya da fonksiyonu kullanılabilir.Amanın! Bu gömme işlemi bulunamadı.Eyvah: %sno-subsetonKomut paletini açBağlantıyı yeni sekmede açMenüyü açPaylaşma penceresini açİsteğe bağlıİsteğe bağlı: Yanıtı belirli alanlarla sınırlandırın. Atlanırsa, tüm alanlar döndürülür.Ya da var olan içeriğe bağlantı verinYa da YouTube adresini yazın:TuruncuSıralamaSıralama özniteliğini artan ya da azalan olarak belirler.ÖzgünÖzgün ek dosya adı.Özgün görsel:Özgün: %s%s altından dışarıVarsayılan özet uzunluğunu değiştirir.Genel görünümPDF gömmePHP %s sürümüPHP XML eklentisi kurulmamış. Lütfen PHP XML eklentisi etkinleştirilmesi için barındırma hizmeti sağlayıcınız ile görüşün.PMSayfaSayfa %sSayfa arşivleriSayfa öznitelikleriSayfa kimliğiSayfa kimlikleri, virgül ile ayrılmış.Sayfa yüklendi.Sayfa arasıSayfa bulunamadıÖndeki sayfaSayfa sıralamasıSayfa özel olarak yayınlandı.Sayfa yayınlandı.Sayfa taslağa dönüştürüldü.Sayfa güncellendi.Sayfa başlığıSayfa çöpe atıldı.Sayfa güncellendi.SayfalarSayfa listesiSayfa listesi gezinmesiSayfalar:SayfalamaParagrafÜst ögeÜst kategoriÜst kategori:Üst gezinme menüsü:Üst sayfa:Üst şablon parçası:Üst şablon:Üst bloklar.Üst ifade bulunamadı.Ekranda çıktının bir bölümünü ya da içerik dizgesini (ya da dizisini) görüntüler. Ancak ikisini birden görüntülemez.Yazı sayısını tam sayı olarak aktarmak kullanımdan kaldırıldı. Bunun yerine değişken dizisi gönderin.ParolaParola sıfırla%s kullanıcısı için parola değiştirildiKullanıcının parolası (asla katılmaz).Parola korumalıBu kullanıcı için parola sıfırlamaya izniniz yokParola:Parolalar boş olamaz.Parolalarda "%s" karakteri kullanılamaz.Yapıştırİnternet adresini yapıştırın ya da arama yapınMetin olarak yapıştırYapıştırma şu an düz metin kipinde. Siz bu ayarı kapatana kadar yapıştırılan içerikler düz metin olarak yapıştırılacak.Tablo satırını ardına yapıştırTablo satırını önüne yapıştırGömme kodunuzu aşağı yapıştırın:Yazı tipi dosyalarının yolları ya da adresleri."%s" modeli bulunamadı.Model kategorileri listesiModel kategorileri listesi gezinmesiModel kategorisi bağlantısıModel içeriği bir dizge olmalıdır.Model adı bir dizge olmalıdır.Model özel olarak yayınlandı.Model yayınlandı.Model taslağa dönüştürüldü.Model zamanlandı.Model başlığı bir dizge olmalıdır.Model güncellendi.Çoğunlukla metin bulunan modeller.Model listesiModeller listesi gezinmesiDüğmeler ve işlem çağrısı bulunan modeller.DurdurBekleyenOnaylanmayı bekleyen <span class="count">(%s)</span>Onaylanmayı bekleyen <span class="count">(%s)</span>Onaylanmayı bekliyorGelişmiş bir terim sorgusu gerçekleştirin.Yazının kalıcı bağlantı şablonu.Kalıcı bağlantı:Kalıcı bağlantı: %sFarsçaFotoblogGeri bağlantıGeri bağlantı özeti: %1$s adresinden %2$s adresine gönderilen geri bağlantı kaydedildi.Geri bildirim:PembeOynatOynatma listesi ayarlarıLütfen PHP %s eklentisinin kurulu ve etkin olup olmadığını kontrol edin.Lütfen daha kapsamlı bir kod yazmayı düşünün.Ayrıntılı bilgi almak için lütfen eklenti geliştiricileri ile görüşün.Lütfen bu konuyu daha ayrıntılı araştırmanıza yardımcı olması için hizmet sağlayıcınız ile görüşün.Lütfen ağ yöneticiniz ile görüşün.Lütfen bir sayfa başlığı yazınLütfen bir site adı yazın.Lütfen bir site başlığı yazın.Lütfen bir kullanıcı adı yazın.Lütfen geçerli bir YouTube adresi yazın.Lütfen geçerli bir e-posta adresi yazın.Lütfen bir öge başlığı yazınLütfen kullanıcı adınızı ya da e-posta adresinizi yazın. Parolanızı nasıl sıfırlayacağınız ile ilgili yönergelerin bulunduğu bir e-posta alacaksınız.Lütfen temanıza bir %s şablonu ekleyin.Lütfen yeniden oturum açın.%2$s uygulamasının hesabınızla bağlantı kurmasına yetki vermek için lütfen %1$s oturumu açın.Yetkilendirmeyi sürdürmek için lütfen %s oturumu açın.Lütfen bu işleve bir sorgu dizisi (query array) gönderin.Lütfen geçerli bir bağlantı belirtin.Ön izlemeyi paylaşabilmek için lütfen değişikliklerinizi kaydedin.Ayrıntılı bilgi almak için lütfen <a href="%s">WordPress hata ayıklama</a> bölümüne bakın.Lütfen yeniden deneyin.Lütfen dosyaları %1$starayıcı yükleyicisini%2$s kullanın.Yeni şema özellikleri eklemek için lütfen %s kullanın.Lütfen bu sitenin <strong>yönetim e-posta adresinin</strong> geçerli olup olmadığını doğrulayın.Eklenti geliştiricisinin site adresi.Eklenti bulunamadı.Şablonu kaydeden eklenti.EklentilerLehçeSık kullanılan model kategorileriYaygın kullanılan etiketlerPortekizceKonumYazıYazı arşivleriYazı öznitelikleriYorum gönderYazı biçimi bağlantısıYazı kimliği.Yazı küçük görseliYazı türü arşiviYazı türü: &#8220;%s&#8221;%s:KenarSesSohbetGaleriGörselBağlantıAlıntıStandartDurumVideoYazı biçimleri destekleniyor.Yazı gezinmesiYazı özel olarak yayınlandı.Yazı yayınlandı.Yazı taslağa dönüştürüldü.Yazı güncellendi.Yazı çöpe atıldı.Yazı türü uzunluğu 1 ile 20 karakter arasında olmalıdır.Şablonları alınacak yazı türü.Yazı güncellendi.Gönderilen başlık:PosterPoster görseliYazılarYazılar sayfası%s tarafından yazılan yazılarYazı listesiYazı listesi gezinmesiYazı gezinmesiYazı sayfasıYazı sayfalamasıYazılar %s tarihinde yayınlandıWordPress'in desteğiyleÖn yüklemeHiçbiriÖn izleme bağlantısıTarayıcı ikonu olarak ön izlemeUygulama ikonu olarak ön izlemeYazının ön izleme bağlantısı.Tema ön izlemesiÖnceki sayfaÖnceki yazıGeçmiş ve gelecek aylarÖnceki sayfaYazdırÖncelikGizlilik PolitikasıGizlilik:ÖzelÖzel <span class="count">(%s)</span>Özel <span class="count">(%s)</span>Özel: %sİstemin yürütülmesi bir süzgeç tarafından engellendi."%1$s" özelliği "%2$s" yeteneği için geçerli bir özellik değil. İzin verilen özellikler için %3$s sınıfını denetleyin."%1$s" özelliği, "%2$s" yetenek kategorisi için geçerli bir özellik değil. İzin verilen özellikler için %3$s sınıfını denetleyin.Sitenizi istenmeyen içeriklerden koruyun.Yorumlar korunuyor: Lütfen yorumları görüntülemek için parolayı yazın.Korumalı: %sHizmet sağlayıcı logosunun yolu. Eklentiler veya zorunlu eklentiler dizininde bulunmalıdır.Herkese açıkHerkese açık ve düzenleyici betik tanıtıcısı. KULLANIMDAN KALDIRILDI: Bunun yerine "script_handles" kullanın.Herkese açık sayfalar ve düzenleyici için betik işleyicisi.Herkese açık ve düzenleyici biçem tanıtıcısı. KULLANIMDAN KALDIRILDI: Bunun yerine "style_handles" kullanın.Herkese açık sayfalar ve düzenleyici biçem tanıtıcıları.Herkese açık betik tanıtıcısı. KULLANIMDAN KALDIRILDI: Bunun yerine "view_script_handles" kullanın.Herkese açık sayfaların betik tanıtıcıları.Herkese açık betik modülü kimlikleri.Herkese açık biçem tanıtıcıları.Genel metin alanı.YayınlaYayınlama ayarlarıYayınlanmışYayınlanmış <span class="count">(%s)</span>Yayınlanmış <span class="count">(%s)</span>MorSorgu parametresine izin verilmiyor: %sHızlı düzenleJerry Herman tarafından Merhaba Dolly şarkısından alıntı:REST API %1$s bir diziler dizisi olmalıdır. %2$s için dizi olmayan değerle karşılaşıldı.JSONREST API rotaları %1$s eylemine kaydedilmelidir. Bunun yerine, '%3$s' ad alanına sahip '%2$s' rotası bu eylemde kaydedilmedi.Yazı türünün temel REST yolu.Sınıflandırmanın REST temel yolu.Sınıflandırmanın REST adlandırma alanı yolu.Yazı türünün REST yolu adlandırma alanı.REST arama işleyicileri %s sınıfını genişletmelidir.RSSRSS sorunu:RSS akışıRastgele sıralamaÖnerilen başlıklar rastgele seçilsinYüklenen başlıklar rastgele seçilsinÖnerilen üst bilgiler rastgele seçiliyorYüklenmiş üst bilgiler rastgele seçiliyor%1$s–%2$s dakikaHam boyut değeri bir dizge, tam sayı ya da float olmalıdır.Devamını okuDevamını oku...<a href="%s" target="_blank">Bir WordPress ağında hata ayıklama</a> belgesini okuyun. Belgedeki bazı öneriler neyin yanlış gittiğini bulmanıza yardımcı olabilir.Salt okunur yetenekler için GET yöntemi gerekir.Silinen kullanıcının yazılarını ve bağlantılarını bu kullanıcı kimliğine atar.Son yorumlarSon YazılarKurtarma kipi &#8212; %sKurtarma kipi hazırlandı. İlerlemek için lütfen oturum açın.Kurtarma kipi hazırlanamadı.Kurtarma anahtarının süresi doldu.Kırmızıİleri alHesap açBu sitede hesap açHesap açma formuKayıt tamamlandı. Lütfen e-postanızı kontrol edin, ardından <a href="%s">oturum açma sayfasına</a> gidin.Hesap açılışı onayı size e-posta ile gönderilecek.Kullanıcının hesap açma tarihi.Hesap açılmasına izin verilmiyor.Beni hatırlaDaha sonra hatırlatKaldırMenü elemanını kaldır: %1$s (%2$s)Ses kaynağını kaldırGörseli kaldırBağlantıyı kaldırPoster görselini kaldırVideo kaynağını kaldırKaldırıldı%1$s özelliğini el ile kaldırmak PHP uyarılarına neden olabilir. Bunun yerine %2$s süzgecini kullanın.Yeniden sıralaMenü elemanlarını yeniden sıralayınYeniden sıralama kipi kapatıldıYeniden sıralama kipi açıkBileşenleri yeniden sıralaArka plan görseli yinelensinYineleDeğiştirSesi değiştirGörseli değiştirVideoyu değiştir%s için yanıtGerekli alanlar %s ile işaretlenmişlerdirSürümlerin çöpe atılması desteklenmediğinden doğru olması gerekli.Terimlerin çöpe atılması desteklenmediğinden doğru olması gerekli.Kullanıcıların çöpe atılması desteklenmediğinden doğru olması gerekli.Gereksinimler karşılanmadıParolayı sıfırlaYanıt&#8220;%s&#8221; için yanıtYanıtlar&#8220;%s&#8221; için yanıtlarUyumlu yerleşimGeri yükleÇöpten çıkarSon taslağa geri dönYedekten geri yükleYeniden deneREST API kullanırken geri dönüş çağrınızda bir %1$s ya da %2$s nesnesi döndürün.Kişiselleştirme, denetim ve erişim farkındalığı davranışını desteklemek için kimliği doğrulanmış geçerli kullanıcının temel profil ayrıntılarını döndürür.Tanılama ve uyumluluk için sitenin altyapısı ile ilgili temel bilgileri döndürür (ortam, PHP runtime, veri tabanı sunucusu bilgileri, WordPress sürümü).Yapılandırılmış WordPress site bilgilerini döndürür. Varsayılan olarak tüm alanları veya isteğe bağlı olarak süzülmüş bir alt kümeyi döndürür.Sıralamayı ters çevirYayınlanmamış değişiklikleri geri al&hellip;SürümSürümlerSürümlerin çöpe atılması desteklenmez. Silmek için '%s' olarak ayarlayın.Sürüm tutma etkinleştirilmemiş.Zengin metin düzenleyici. Alt-Shift-H ile yardım alabilirsiniz.Zengin metin alanı. Yardım almak için Control-Option-H tuşlarına basın.SağRobotlarKullanıcıya atanmış roller.RomenceDöndürmeDöndürme değişkenleri.Döndürme türü.Rota belirtilmelidir. Bunun yerine '%1$s' ad alanı içinde boş bir '%2$s' rotası var gibi görünüyor.Rotalar, eklenti veya tema adı ve sürümüyle birlikte ad alanına sahip olmalıdır. Bunun yerine '%2$s' rotası için boş bir '%1$s' ad alanı var gibi görünüyor.SatırSatır grubuSatır türüSatırlarRusçaSMTP hatası: Kimlik doğrulanamadı.SMTP hatası: SMTP sunucusu ile bağlantı kurulamadı.SMTP Hatası: Veri kabul edilmedi.SMTP hatası: Şu alıcılar başarısız oldu: SMTP kodu: SMTP connect() işlevi başarısız oldu.SMTP sunucu hatası: SSL doğrulaması yapılamadı.CtsCumartesiCKaydetKaydet ve yayınlaTaslak olarak kaydetParolayı kaydetYayınlamadan önce değişiklikleri kaydedip ön izleyin.Daha sonraki yorumlarımda kullanılması için adım, e-posta adresim ve site adresim bu tarayıcıya kaydedilsin.KaydedildiKaydedildi.Özelleştirme değişikliklerinizi gelecekteki bir tarihte yayınlamak ("canlıya geçmek") üzere zamanlayın.ZamanlandıZamanlanmış <span class="count">(%s)</span>Zamanlanmış <span class="count">(%s)</span>Altında istek yapılan kapsam. Yanıtta bulunacak alanları belirler.Temizlik anahtarı denetimi başarısız oldu. Lütfen yeniden deneyin.Ekran okuyucu kullanıcıları: Form kipindeyken Esc tuşuna iki kez basmanız gerekebilir.Betikler ve biçemler %1$s, %2$s, ya da %3$s kancalarından önce kayıt edilmemeli ya da sıraya alınmamalıdır.Sayfa ile beraber kaydırAraKategorilerde araDeğişim kümesi araBağlantı kategorilerinde araMenü ögesi araGezinme menüsü araSayfalarda araModel kategorisi araModel araYazılarda araArama sonuçları %1$s %2$s&#8220;%s&#8221; için arama sonuçlarıEtiketlerde araŞablon parçası araŞablon araArama bileşenleriWordPress.org temalarında araOrtam araOrtam dosyalarında ara...Bir öge seçmek için arama yapın ya da yukarı ve aşağı tuşlarını kullanın.Arama sonuçları%s için arama sonuçları&#8220;%s&#8221; için arama sonuçlarıTema araAraMevsimselBelirli bir işlemi tetikleme amacı taşıyan bölümler.Güvenlik kontrolü başarısız oldu.Güvenlik hatası.Sitenizde değişikliklerin nasıl olacağını canlı olarak görün ve özelleştiriciye erişme izni olmayan kişilerle ön izleme paylaşın.Seç%s bloğunu seçKategori seçinGün seçinDosya seçinBağlantı kategorisi seçin:Menü seçin:Ay seçinYazı seçinSite simgesini seçinHafta seçinYıl seçinŞehir seçinTümünü seçBu bileşeni taşıyacak bir alan seçin:Seç ve kırpSes seçinDosya seçGörsel seçinLogo seçinPoster görseli seçinVideo seçinSeçilmiş ortam işlemleriModel kategorilerini virgül ile ayırarak yazınEtiketleri virgül ile ayırarak yazınEylülEylSırpçaKopya ayarlarına kodlamak için serileştirilmiş bileşen formu verileri.Unicode adreslerine gönderim için gereken SMTPUTF8 sunucuda desteklenmiyorOturum belirteciOturum süresi dolduGörsel ayarlaAyar bulunamadı ya da anlaşılamadı.Canlı ön izlemeniz ayarlanıyor. Bu işlem biraz zaman alabilir.AyarlarKeskinDerinDoğalAna HatlıKeskinÖn izleme bağlantısını paylaşMarkanız/işletmeniz hakkında yorumları ve geri bildirimleri paylaşın.Paylaşma seçenekleriShift + Alt + harf:Bu bileşeni düzenlemek için Shift ile tıklayın.Bu bileşeni düzenlemek için Shift tuşu ile beraber tıklayın.BGRKısa bağlantıGösterYardımcı kayıtlar listesinde sanatçı adını görüntüleGörselleri görüntüleBağlantı açıklamasını görüntüleBağlantı görselini görüntüleBağlantı adını görüntüleBağlantı değerlendirmesini görüntüleYardımcı kayıt listesini görüntüleVideo listesini görüntüleHiyerarşiyi görüntüleGörünmez karakterleri görüntüleÖnde görüntüleParolayı görüntüleYazı sayılarını görüntüleEtiket sayılarını görüntüleSon çalışmanızı sergileyin.Bilgileri görüntülenen tema: %sKenar çubuğuKenar çubuğu %dHesap açİmzalama hatası: GümüşTek öge: %sSiteSite %dSite adresi (URL)Site yönetimiSite etki alanı (yalnızca alt etki alanı):Site kimliği boş olamaz.Site simgesiSite kimliğiSite dili:Site adı (yalnızca alt klasör):Site adı: %sSite ön izlemeSite sloganıSite başlığıSite başlığı:Site adresi.Site bulunamadı.Site alan adı boş bırakılamaz.Site simgesi.Site logosu.Site adı en az %s karakter uzunluğunda olmalıdır.Site adı en az %s karakter uzunluğunda olmalıdır.Site adında yalnızca küçük harfler (a-z) ve rakamlar bulunabilir.Site ağ kimliği belirtilmeli.Site yolu boş bırakılamaz.Sitede hesap açılmasına izin verilmiyor.Site sloganı.Site başlığı.Belirtilen kimlikle bir site bulunamadı.SitelerZaten üyesi olduğunuz siteler:BoyutKırpmayı atlaİçeriğe geçAraç çubuğuna atlaSlovakçaSloven DiliBiraz yavaşlayın, yeni e-postalara bu kadar sık bakmana gerek yok!Adres son ekiAdres son eki yazı başlığından otomatik olarak oluşturuldu.KüçükYazılım adıYazılım sürümüBazı HTML kod imlerine izin verilmiyor. Örneğin:%1$s %2$s değerlerinden bazıları geçersizGerekli bazı eklentiler eksik ya da etkisiz.Birisi şu hesap için parola sıfırlama isteğinde bulundu:Ne yazık ki, bu ögeye yorum yapma özelliği kapatılmış.Ne yazık ki, bu öge için yorumlara izin verilmiyor.Ne yazık ki, terim silinemedi.Ne yazık ki, terim düzenlenemedi.Ne yazık ki, bir kullanıcı yalnızca çoklu sitede istenmeyen olarak işaretlenebilir.Ne yazık ki, şu anda yeni hesaplar açılmasına izin verilmiyor.Ne yazık ki, böyle bir sayfa yok.Ne yazık ki, böyle bir yazı yok.Ne yazık ki, belirtilen sınıflandırmalardan biri bu yazı türü tarafından desteklenmiyor.Ne yazık ki, onaylanmamış yorumlara yanıt verilmesine izin verilmiyor.Ne yazık ki, sürüm özelliği etkin değil.Ne yazık ki, site adlarında harfler de bulunmalıdır!Ne yazık ki, bu e-posta adresi zaten kullanılıyor!Ne yazık ki, bu e-posta adresine izin verilmiyor!Ne yazık ki, bu site zaten var!Ne yazık ki, bu site ayırtılmış!Ne yazık ki, bu kullanıcı adı zaten kullanılıyor!Ne yazık ki, bu kullanıcı adına izin verilmiyor.Ne yazık ki, kategori oluşturulamadı.Ne yazık ki, yorumunuz düzenlenemedi.Ne yazık ki, yazı oluşturulamadı.Ne yazık ki, yazı silinemedi.Ne yazık ki, yazı güncellenemedi.Ne yazık ki, teriminiz oluşturulamadı.Ne yazık ki, kullanıcı güncellenemedi.Ne yazık ki, belirtilen adresteki video yüklenemedi. Lütfen adreste desteklenen bir video dosyası (%s) ya da akış (YouTube ve Vimeo gibi) olup olmadığını kontrol edin.Ne yazık ki, bu yöntem desteklenmiyor.Ne yazık ki, bu yazı türünde notlar desteklenmiyor.Ne yazık ki, bu öge için geri izlemeler kapalı.Ne yazık ki, kullanıcı adlarında harfler de bulunmalı!Ne yazık ki, bu site ile ilgili bilgilere erişme izniniz yok.Ne yazık ki, bu yazı ile ilgili bilgilere erişme izniniz yok.Ne yazık ki, yazı tipi derlemelerine erişme izniniz yok.Ne yazık ki, yazı tipi yüzlerine erişme izniniz yok.Ne yazık ki, yazı tipi ailelerine erişme izniniz yok.Ne yazık ki, bu sitedeki genel biçemlere erişme izniniz yok.Ne yazık ki, bu sitedeki şablonlara erişme izniniz yok.Ne yazık ki, bu yazı tipi yüzüne erişme izniniz yok.Ne yazık ki, bu yazı tipi ailesine erişme izniniz yok.Ne yazık ki, bu sitedeki kullanıcı bilgilerine erişme izniniz yok.Ne yazık ki, eklentileri etkinleştirme izniniz yok.Ne yazık ki, bu eklentiyi etkinleştirme izniniz yok.Ne yazık ki, bu kategoriyi ekleme izniniz yok.Ne yazık ki, belirtilen sınıflandırmalardan birine terim ekleme izniniz yok.Ne yazık ki, belirtilen sınıflandırmalardan biri için bir terim atama izniniz yok.Ne yazık ki, bu sınıflandırmaya terim atama izniniz yok.Ne yazık ki, belirtilen terimleri atama izniniz yok.Ne yazık ki, bu terimi atama izniniz yok.Ne yazık ki, blok klasörüne göz atma izniniz yok.Ne yazık ki, yerel blok model klasörüne göz atma izniniz yok.Ne yazık ki, yorum türünü değiştirme izniniz yok.Ne yazık ki, bu kullanıcı olarak sayfaların yazarlarını değiştirme izniniz yok.Ne yazık ki, bu kullanıcı olarak yazıların yazarlarını değiştirme izniniz yok.Ne yazık ki, bu yazıya yorum yapma izniniz yok.Ne yazık ki, bu kullanıcı olarak gezinme menüsü oluşturma izniniz yok.Ne yazık ki, bu yazıya yorum yapma izniniz yok.Ne yazık ki, bu kullanıcı için uygulama parolaları oluşturma izniniz yok.Ne yazık ki, yeni yazı oluşturma izniniz yok.Ne yazık ki, bu yazı için not oluşturma izniniz yok.Ne yazık ki, bu kullanıcı ile sayfa oluşturma izniniz yok.Ne yazık ki, bu yazı türünde parola ile korunan bir yazı oluşturma izniniz yok.Ne yazık ki, bu kullanıcı adına yazı oluşturma izniniz yok.Ne yazık ki, bu yazı türünde özel yazı oluşturma izniniz yok.Ne yazık ki, bu sınıflandırmada yeni terimler oluşturma izniniz yok.Ne yazık ki, bir yazı olmadan yorum yapma izniniz yok.Ne yazık ki, bu siteyi özelleştirme izniniz yok.Ne yazık ki, bu eklentiyi etkisizleştirme izniniz yok.Ne yazık ki, bu kullanıcı için uygulama parolalarını silme izniniz yok.Ne yazık ki, bu sitede eklentileri silme izniniz yok.Ne yazık ki, bu yazının sürümlerini silme izniniz yok.Ne yazık ki, bu uygulama parolasını silme izniniz yok.Ne yazık ki, bu kategoriyi silme izniniz yok.Ne yazık ki, yorumu silme izniniz yok.Ne yazık ki, bu sayfayı silme izniniz yok.Ne yazık ki, bu yazıyı silme izniniz yok.Ne yazık ki, bu sürümü silme izniniz yok.Ne yazık ki, bu terimi silme izniniz yok.Ne yazık ki, bu kullanıcıyı silme izniniz yok.Ne yazık ki, bunu yapma izniniz yok.Ne yazık ki, '%s' yorumunu düzenleme izniniz yok.Ne yazık ki, bu kullanıcı olarak gezinme menülerini düzenleme izniniz yok.Ne yazık ki, yorumları düzenleme izniniz yok.Ne yazık ki, sayfaları düzenleme izniniz yok.Ne yazık ki, bu yazı türündeki yazıları düzenleme izniniz yok.Ne yazık ki, yazıları düzenleme izniniz yok.Ne yazık ki, bu kullanıcının rollerini düzenleme izniniz yok.Ne yazık ki, bu sınıflandırmadaki terimleri düzenleme izniniz yok.Ne yazık ki, %s özel alanını düzenleme izniniz yok.Ne yazık ki, bu sitedeki tema ayarlarını düzenleme izniniz yok.Ne yazık ki, bu uygulama parolasını düzenleme izniniz yok.Ne yazık ki, bu yorumu düzenleme izniniz yok.Ne yazık ki, bu genel biçemi düzenleme izniniz yok.Ne yazık ki, bu sayfayı düzenleme izniniz yok.Ne yazık ki, bu yazıyı düzenleme izniniz yok.Ne yazık ki, bu terimi düzenleme izniniz yok.Ne yazık ki, bu kullanıcıyı düzenleme izniniz yok.Ne yazık ki, kullanıcıları düzenleme izniniz yok.Ne yazık ki, kullanıcı profilinizi düzenleme izniniz yok.Ne yazık ki, bu yeteneği kullanamazsınız.Ne yazık ki, şablonları ve şablon parçalarını dışa aktarma izniniz yok.Ne yazık ki, kullanıcıları yetkinliklerine göre süzme izniniz yok.Ne yazık ki, kullanıcıları role göre süzme izniniz yok.Ne yazık ki, kullanıcıya bu rolü verme izniniz yok.Ne yazık ki, bu siteye eklenti kurma izniniz yok.Ne yazık ki, bu kullanıcı için uygulama parolalarını listeleme izniniz yok.Ne yazık ki, kullanıcıları listeleme izniniz yok.Ne yazık ki, yazıları sabitleme izniniz yok.Ne yazık ki, vekil sunucudan geçen oEmbed istekleri yapma izniniz yok.Ne yazık ki, bu kullanıcı için uygulama parolalarını yönetme izniniz yok.Ne yazık ki, blok türlerini yönetme izniniz yok.Ne yazık ki, ağ eklentilerini yönetme izniniz yok.Ne yazık ki, bu sitedeki eklentileri yönetme izniniz yok.Ne yazık ki, yazı durumlarını yönetme izniniz yok.Ne yazık ki, bu sınıflandırmadaki terimleri yönetme izniniz yok.Ne yazık ki, bu eklentiyi yönetme izniniz yok.Ne yazık ki, bu sitedeki bileşenleri yönetme izniniz yok.Ne yazık ki, bu yorumu düzenleme ya da onaylama izniniz yok.Ne yazık ki, kullanıcıları bu parametreye göre sıralama izniniz yok.Ne yazık ki, bu sitede yazı yazma izniniz yok.Ne yazık ki, taslakları ön izleme izniniz yok.Ne yazık ki, uzak adresleri işleme izniniz yok.Ne yazık ki, bu sitede sayfa yayınlama izniniz yok.Ne yazık ki, bu yazı türündeki yazıları yayınlama izniniz yok.Ne yazık ki, bu sitede yazı yayınlama izniniz yok.Ne yazık ki, bu sayfayı yayınlama izniniz yok.Ne yazık ki, bu blogda yazı yayınlama izniniz yok.Ne yazık ki, bu parametre ile kullanıcıları sorgulama izniniz yok.Ne yazık ki, bu kullanıcı olarak blokları okuma izniniz yok.Ne yazık ki, bu yazının bloklarını okuma izniniz yok.Ne yazık ki, bir yazı olmadan yorumları okuma izniniz yok.Ne yazık ki, bu yorumun yazısını okuma izniniz yok.Ne yazık ki, bu uygulama parolasını okuma izniniz yok.Ne yazık ki, bu yorumu okuma izniniz yok.Ne yazık ki, ögeyi devralma izniniz yok.Ne yazık ki, ayarları güncelleme izniniz yok.Ne yazık ki, bu kullanıcı olarak yazıları güncelleme izniniz yok.Ne yazık ki, bu dosyaları yükleme izniniz yok.Ne yazık ki, bu siteye ortam yükleme izniniz yok.Ne yazık ki, bu yazıya ortam yükleme izniniz yok.Ne yazık ki, bu dosya türünü yükleme izniniz yok.Ne yazık ki, bu yazının otomatik kayıtlarını görüntüleme izniniz yok.Ne yazık ki menü ögelerini görüntüleme izniniz yok.Ne yazık ki, menü konumlarını görüntüleme izniniz yok.Ne yazık ki, menüleri görüntüleme izniniz yok.Ne yazık ki, bu yazının sürümlerini görüntüleme izniniz yok.Ne yazık ki, bu yazının terimlerini görüntüleme izniniz yok.Ne yazık ki, etkin temayı görüntüleme izniniz yok.Ne yazık ki, kaydedilmiş blok modeli kategorilerini görüntüleme izniniz yok.Ne yazık ki, kaydedilmiş blok modellerini görüntüleme izniniz yok.Ne yazık ki, kaydedilmiş simgeleri görüntüleme izniniz yok.Ne yazık ki, temaları görüntüleme izniniz yok.Ne yazık ki, bu genel biçemi görüntüleme izniniz yok.Ne yazık ki, bu yazıyı görüntüleme izniniz yok.Ne yazık ki, zamanlanmış ya da taslak olarak kaydedilmiş değişiklikler varsa yeni temaların ön izlemesi görüntülenemez. Lütfen yeni temaların ön izlemesini görüntülemek için değişikliklerinizi yayınlayın ya da yayınlanmasını bekleyin.Ne yazık ki, bir özel yazıyı sabitleyemezsiniz.Ne yazık ki, size ayrılmış %s depolama alanını doldurdunuz. Lütfen daha fazla dosya yükleyebilmek için bazı dosyaları silin.Ne yazık ki, bu site adını kullanamazsınız.Ne yazık ki, kategorileri görüntülemek için bu sitede yazıları düzenleme izniniz olmalıdır.Ne yazık ki, etiketleri görüntülemek için bu sitede yazıları düzenleme izniniz olmalıdır.Kusura bakmayın. Yorum yapmak için oturum açmalısınız.Sırala:Derlemeyi yorum özniteliğine göre sıralar.Derlemeyi nesne özniteliğine göre sıralar.Derlemeyi yazı özniteliğine göre sıralar.Derlemeyi terim özniteliklerine göre sıralar.Derlemeyi kullanıcı özniteliğine göre sıralar.KaynakKaynak koduÖzelleştirilmiş şablonun kaynağıŞablonun kaynağıİstenmeyen: %sİspanyolcaÖzel karakterTablo hücresini bölÇizelge <span class="count">(%s)</span>Çizelgeler <span class="count">(%s)</span>ÇizelgelerYorumun durumu.DurumDurum yasaklı.Kenar çubuğunun durumu.Şablonun durumu.SabitHâlâ e-posta mı bekliyorsunuz?Zorluk göstergesiÜzeri çiziliBiçemBiçem çeşitleriBiçem sayfasıBiçem sayfası eksik.Biçem sayfası okunabilir değil.GönderAramayı yapİnceleme için gönderAlt simgeÖnerilen görsel boyutları %1$s x %2$s piksel.PazPazarPÜst simgeDestekSvahili DiliİsveççeTablo hücresi özellikleriİçindekiler tablosuTablo özellikleriTablo satırı özellikleriEtiket bulutuTagalogcaSloganEtiketlerTemanın biçemlerini ve özelliklerini gösteren kod imleri.Etiket listesiEtiket listesi gezinmesiEtiketler: DevralOrta koyuHedefYazı türü ile ilişkilendirilmiş sınıflandırmalar.Sınıflandırma adlarının uzunluğu 1 ile 32 karakter arasında olmalıdır.Sınıflandırma:Şablon"%s" şablonu zaten kayıtlı."%s" şablonu kayıtlı değil.Şablon parçası alanıŞablon parçası alanlarıŞablon parçalarıŞablon arşivleri%s için şablonŞablon eksik. Tekil temalar %1$s ya da %2$s şablon dosyasına gerek duyarlar. <a href="%3$s">Alt temalar</a> %5$s biçem sayfası içinde %4$s üst bilgisine gerek duyarlar.Tüm arşivYazar arşiviBlog girişiKategori arşiviTarih arşiviÖn sayfaDizinSayfa: 404SayfalarYazı biçimi: %sArama sonuçlarıTekil kayıtlarTekil yazılarEtiket arşivleriSınıflandırmaŞablon adları dizelerden oluşmalıdır.Şablon adlarında bir ad alanı ön eki bulunmalıdır. Örnek: eklentim//ozel-sablonumŞablon adları büyük harf karakterleri içermemelidir.Şablon parçası arşivleriŞablon parçası silinmiş ya da kullanılamıyor: %sŞablon parçası güncellendi.Şablon parçaları listesiŞablon parçaları listesi gezinmesiTemanıza katılacak şablon parçaları.Şablon güncellendiŞablonlarTema dosyası temelli şablonlar kaldırılamaz.Tema dosyalarını temel alan şablonların sürümleri olamaz.Şablon listesiŞablon listesi gezinmesiTemanıza katılacak şablonlar.Terim kimlikleri listesiTerim kimliği sınıflandırma sorgusuTerim kimliği birden çok sınıflandırma ile paylaşılıyorTerim kimlikleri.Terim bulunamadı.Sınıflandırmalar arasında paylaşılan terimlere terim üst verileri eklenemez.Terimlerin çöpe atılması desteklenmez. Silmek için '%s' olarak ayarlayın.MetinGPT ve Dall-E ile metin ve görsel oluşturma.Gemini ve Imagen ile metin ve görsel oluşturma.Yazı rengiBu menü ögesinin bağlantı bileşeninin başlık özniteliği metni.Claude ile metin oluşturma.Görüntülenecek metinTay DiliSilme isteğinizi onayladığınız için teşekkür ederiz.Dışa aktarım talebinizi onayladığınız için teşekkürler.Bu ses dosyası bulunamadı. <a href="%s">Ortam kitaplığına</a> bakın ve silinmediğinden emin olun.Bu e-posta adresi etkinleştirilmeyi bekliyor ve yeni kayıt için kullanılamıyor. Bu e-posta adresiyle daha önce bir deneme yaptıysanız, lütfen gelen kutunuzda etkinleştirme e-postasını arayın. Onaylanmamış olarak kalırsa, birkaç gün içinde kullanılabilir olur.Bu dosya bulunamadı. <a href="%s">Ortam kitaplığına</a> bakın ve silinmediğinden emin olun.Bu görsel bulunamadı. <a href="%s">Ortam kitaplığına</a> bakın ve silinmediğinden emin olun.Bu adın kullanılmasına izin verilmiyor.Bu site şu an için ayrılmış durumda ama birkaç güne kalmaz müsait olur.Bu kullanıcı bulunamadı.Bu kullanıcı adı zaten etkin.Bu kullanıcı adı şu an ayırtılmış durumda, fakat birkaç gün içinde müsait olabilir.Bu video bulunamadı. <a href="%s">Ortam kitaplığına</a> bakın ve silinmediğinden emin olun."%1$s" seçenek anahtarı "%2$s" olarak değişti."%1$s" sınıflandırma "%2$s" özelliği (%3$s), REST API yazılar denetleyicisindeki var olan bir özellik ile çakışıyor. Bu sorunu önlemek için sınıflandırmayı kaydederken özel bir "rest_base" belirtin."%s" çağrılabilir bir işlev olmalıdır."%s" seçenek grubu silindi. Başka bir seçenek grubu kullanın."%s" teması geçerli bir üst tema değil."get_value_callback" parametresi geçerli bir geri çağrı olmalıdır.%1$s için "type" şema anahtar sözcüğü yalnızca iç türlerde olabilir: %2$l.%1$s için "type" anahtar sözcüğü yalnızca iç türleri içerebilir: %2$l.%s için "type" şema anahtar sözcüğü gereklidir."uses_context" parametresi bir dizi olmalıdır.$source_properties dizisinde geçersiz özellikler var.$source_properties içinde bir "get_value_callback" bulunmalıdır.$source_properties içinde bir "label" bulunmalıdır.%1$s süzgeci, 0 değerinden büyük bir tam sayı döndürmelidir.%2$s yordam ailesindeki %1$s yordamı artık kullanılmıyor. Bunun yerine %3$s yordamını kullanın.%2$s yordam ailesindeki %1$s seçeneği artık kullanılmıyor. Bunun yerine %3$s seçeneğini kullanın.%1$s parametresi bir dizi olmalıdır. Komut dosyalarına rastgele verileri iletmek için bunun yerine %2$s işlevini kullanın.%1$s, %2$s ve %3$s değerleri video kaydının dili ve türü için düzenlenebilir olarak ayarlanmıştır.%s bağımsız değişkeni bir dizge ya da dizge dizisi olmalıdır.%s sabiti artık desteklenmiyor.%s filtresi negatif olmayan bir sayı döndürmelidir.%s anahtarı boşluk içermeyen bir dizge olmalıdır.%s parametresi boş olmamalıdır.%s özelliği için kaydedilmiş değer geçersiz ve null olarak güncellenemedi.%s tablosu kurulu değil. Ağ veri tabanı yükseltmesini çalıştırın.&#8220;Adres son eki&#8221; yazı adının adresine eklenecek sürümüdür. Genellikle küçük harflerden oluşur ve yalnızca harf, rakam ve tire karakterleri bulunabilir.CSS kodunda "%s" bulunmamalıdır.CSS kodu "%s" ile bitmemelidir.Varsa, bu ögenin üst menü ögesindeki nav_menu_item veri tabanı ID değeri, yoksa 0.WordPress 6.3 sürümünden sonra ortam düzenleme ekranı kullanımdan kaldırıldı. Onun yerine ortam kitaplığını kullanın.Alt bilgi şablonu genellikle telif hakkı, sosyal ağ bağlantıları ya da diğer blok kombinasyonlarının bulunduğu bir sayfa alanını tanımlar.GD görsel kitaplığı kurulu değil.Uygulama parolasının oluşturulduğu GMT tarihi.Uygulama parolasının son kullanıldığı GMT tarihi.HTML parametresi bir dizge olmalıdır.Üst bilgi şablonu, genellikle bir başlık, logo ve ana gezinme menüsünün bulunduğu bir sayfa alanını tanımlar.Ek dosyanın bulunduğu yazının kimliği.Yazının yazarının kimliği.Sürüm yazarının kimliği.Tema geliştiricisinin kimliği.Otomatik kaydın kimliği.Yazı tipi yüzünün üst yazı ailesinin kimliği.Otomatik kaydın üst ögesinin kimliği.Yorumun üst ögesinin kimliği.Genel biçemler sürümün üst ögesinin kimliği.Nesnenin üst ögesinin kimliği.Yazının üst ögesinin kimliği.Sürümün üst ögesinin kimliği.Atanmış menünün kimliği.İlişkilendirilmiş yazı nesnesinin kimliği.Yazının öne çıkarılmış ortam kimliği.Ön sayfada görüntülenmesi gereken sayfanın kimliğiSon yazıların görüntüleneceği sayfanın kimliğiYazar bir kullanıcı ise, kullanıcı nesnesinin kimliği.Yazı tipi ailesindeki yazı tipi yüzlerinin kimlikleri.Uygulama parolasının son kullanıldığı IP adresi.Gezinme kaplaması şablonu, genellikle gezinme bağlantılarının bulunduğu ve açık ya da kapalı olarak değiştirilebilen bir kaplama alanı tanımlar.Adresteki %1$s veya %2$s bileşeninin Open Graph görsel bağlantısı.WordPress çalıştıran PHP altyapısı sürümü.Press This eklentisi gereklidir.REST API artık tümüyle kapatılamaz. Bunun yerine %s süzgeci ile API erişimini kısıtlayabilirsiniz.%1$s için tanımlı olan REST API yolunda, gerekli olan %2$s değişkeni bulunmuyor. Herkese açık olacak REST API yolları için izin çağrısı olarak %3$s kullanın.REST rota parametresi bir dizge olmalıdır.Sunucunun SSL sertifikası doğrulanamadı.Site simgesi, tarayıcı sekmelerinde, yer işareti çubuklarında ve WordPress mobil uygulamalarında gördüğünüz şeydir. Kare olmalı ve en az <code>%1$s x %2$s</code> piksel olmalıdır.Yazdığınız adres geçerli bir site adresi değil. Lütfen geçerli bir site adresi yazın.Tema üst bilgisinde bulunan tema sitesinin adresi.Temanın sitesinin görüntülenmek üzere dönüştürülmüş adresi.Tema sitesinin adresi.oEmbed verisinin alınacağı kaynağın adresi.İşlenecek adres.Yönetim bölümü adresiBu menü ögesinin gösterdiği adres.Yazdığınız adres bir e-posta adresi gibi görünüyor. Adresin başına olması gereken mailto: ön ekinin eklenmesini ister misiniz?Yazdığınız adres bir dış adres gibi görünüyor. Adresin başına olması gereken http:// ön ekinin eklenmesini ister misiniz?Kullanıcı için adres dostu ad.Yazdığınız WordPress adresi geçerli bir site adresi değil. Lütfen geçerli bir site adresi yazın.Bu sitede çalışan WordPress çekirdek sürümü.WordPress kurulum adresi.WordPress sürümü.Blok yazarının WordPress.org kullanıcı adı.Bu menü ögesinin bağlantısında ifade edilen XFN ilişkisi.%s yeteneği bulunamadı.Ability bağımsız değişkenlerinde, WP_Ability özelliklerini artıran geçerli bir `ability_class` bulunmalıdır.Yetenek kategorisi özelliklerinde bir `description` dizgesi bulunmalıdır.Yetenek kategorisi özelliklerinde bir `label` dizgesi bulunmalıdır.Yetenek kategorisi özelliklerinde geçerli bir `meta` dizisi bulunmalıdır.Yetenek kategorisinin adres son eki boş bırakılamaz.Yetenek üst verisinde geçerli bir `annotations` dizisi bulunmalıdır.Yetenek üst verilerinde geçerli bir `show_in_rest` ikili değeri bulunmalıdır.Yetenek özelliklerinde bir `category` dizgesi bulunmalıdır.Yetenek özelliklerinde bir `description` dizgesi bulunmalıdır.Yetenek özelliklerinde bir `label` dizgesi bulunmalıdır.Yetenek özelliklerinde geçerli bir `execute_callback` işlevi bulunmalıdır.Yetenek özelliklerinde geçerli bir `permission_callback` işlevi bulunmalıdır.Yetenek özelliklerinde geçerli bir `input_schema` tanımı bulunmalıdır.Yetenek özelliklerinde geçerli bir `meta` dizisi bulunmalıdır.Yetenek özelliklerinde geçerli bir `output_schema` tanımı bulunmalıdır.Görseli saat yönünde derece cinsinden döndürme miktarı. KULLANIMDAN KALDIRILDI: Bunun yerine "değiştiriciler" kullanın.Ek dosya MIME türü.Ek dosya başlığı.Ek dosya açıklaması.İç bloğun öznitelikleri.Örnekte kullanılan öznitelikler.Kimliği doğrulanmış uygulama parolası yalnızca geçerli kullanıcı için görülebilir.Aynı yazar tarafından yayınlanan blokların ortalama puanı.Bu yazının tarayıcınızdaki yedeği aşağıdaki sürümden farklı.Blok simgesi.Adlandırma alanı/blok-adı biçiminde blok adı.Blok adres son eki.Bu blok şablonu bir yazı türü ile ilişkilendirilmiş.Okunabilir biçimde blok başlığı.Bu modeli kullanabilen blok türleri.Yayınlanmış yazı olmadığı için takvim bloğu gizlendi.%2$s içindeki %1$s oluşturucu yöntemi %3$s sürümünden başlayarak <strong>kullanımdan kaldırıldı</strong>! Yerine %4$s kullanın.Çağrılan %1$s yordamı %2$s sürümünden başlayarak <strong>kullanımdan kaldırılmış</strong>! Lütfen bunun yerine %3$s kullanın.Yazı tipi derlemesinin kategorileri.İnsan tarafından okunabilir biçimde kategori açıklaması.İnsanlar tarafından okunabilir biçimde kategori etiketi.Kategori adı.Bu sınamanın gruplandırıldığı kategori.Bu sayfadan ayrılırsanız yapmış olduğunuz değişiklikler kaybolur.Yorum silinemez.Yorumların çöpe atılması desteklenmez. Silmek için '%s' olarak ayarlayın.Yorum zaten çöpte.Bu kişisel veri isteğinde onay anahtarının süresi dolmuş.Bu kişisel veri isteğinin onay anahtarı geçersiz.Bu kişisel veri isteğinde onay anahtarı eksik.Bağlayıcı kayıt defteri örneği ‎<code>init‎</code> işlemi sırasında ayarlanmalıdır.%1$s sabiti <strong>kullanımdan kaldırıldı</strong>. Alt etki alanı yapılandırmasını değiştirmek için, %3$s dosyası içinde bulunan %2$s ikili sabitini kullanın. ile Alt etki alanı yapılandırması var mı kontrol etmek için %4$s kullanın.Yorum için içerik.Yazının içeriği.Adresteki %s bileşeninin içeriği.Adresteki %s bileşeninin içeriği.Bağlam yalnızca yönerge işlenirken okunabilir."%s" bağlam bileşeni desteklenmiyor.Bağlam bileşeni boş bir bileşen olamaz. "%s" bulundu.Bağlam bileşeni bir başlangıç etiketi olmalıdır.Zamanlanmış görev olay listesi kaydedilemedi.Geçerli görselin alternatif metni yok. Dosya adı: %sGeçerli kullanıcı %s sınıflandırması içinde terim(ler) atayabilir.Geçerli kullanıcı bu yazıda yazarı değiştirebilir.Geçerli kullanıcı %s sınıflandırması içinde terim(ler) oluşturabilir.Geçerli kullanıcı süzülmeden HTML kodu ve JavaScript içerikleri gönderebilir.Geçerli kullanıcı bu yazıyı yayınlayabilir.Geçerli kullanıcı bu yazıyı sabitleyebilir.Bu menü ögesinin gösterdiği özgün nesnenin veri tabanı kimliği. Örneğin yazılar için ID ya da kategoriler için term_id.Veri tabanı sunucusu ile bağlantı kurulabiliyor (bu durum kullanıcı adı ve parolanızın doğru olduğu anlamına gelir) fakat %s veri tabanı seçilemedi.Sürücü tarafından bildirilen veri tabanı sunucusu üreticisi ve sürüm dizgesi.Ayarların güncellendiği tarih ve saat.GMT olarak yorumun yayınlandığı tarih.Sitenin saat diliminde yorumun yayınlanma tarihi.GMT olarak yazının son değiştirildiği tarih.Sitenin saat diliminde yazının son değiştirilme tarihi.Yazının yayınlandığı tarih, GMT olarak.Sitenin saat diliminde yazının yayınlanma tarihi.GMT olarak sürümün son değiştirilme tarihi.Sitenin saat diliminde sürümün son değiştirilme tarihi.GMT olarak sürümün yayınlandığı tarih.Sitenin saat diliminde sürümün yayınlandığı tarih.Sitenin saat diliminde şablonun son değiştirilme tarihi.İnsan tarafından okunabilir biçimde bloğun en son güncellendiği tarih.Bloğun son güncellenme tarihi.Yazı tipi derlemesinin açıklaması.Tanım bölümü varsayılan olarak ön planda değildir, yine de bazı temalar bu bölümü görüntüleyebilir.Menü konumunun açıklaması.Menü ögesinin açıklaması.Etkin tema destekliyorsa açıklama menüde görüntülenir.Kullanıcının görüntülenecek adı.“%1$s" çift ton kimliği %2$s ayarlarında kaydedilmemiş"%s" isteklilik değeri belge düzeyinde kurgu kuralları için kullanılamaz.Düzenleme alanında otomatik olarak sözdizimi vurgulaması yapılır. Bu özelliği <a href="%1$s" %2$s>kullanıcı profili%3$s</a> sayfasından kapatarak düz metin kipinde çalışabilirsiniz.Bileşen yalnızca yönerge işleme sırasında okunabilir.Yazılan adres geçerli bir e-posta adresi değil. Lütfen geçerli bir e-posta adresi yazın.Kullanıcının e-posta adresi.E-posta gönderilemedi. Olası neden: Sunucunuz %s işlevini kullanmıyor olabilir.Bu e-posta doğruYazının özeti."post_type" ya da "taxonomy" gibi temsil edilen nesnelerin ailesi.Adresteki %s bileşeninin favicon görseli bağlantısı."type" özelliği geçerli bir JSON şeması türü değil.Dosyanın İnternet adresi panonuza kopyalandıDosya sistemi şu anda eklentileri yönetmek için kullanılamıyor.%1$s için %2$s gerekliAşağıdaki Kimden adresi başarısız oldu: Enter tuşuna basılırken aşağıdaki biçimlendirme kısayolları değiştirildi. Escape ya da geri al tuşuna basarak geri alabilirsiniz.Önce şu eklentiler etkinleştirilmelidir: %s.Şu değerler geçerli bir tarihi ifade etmiyorlar: Ay %1$s, Gün %2$s.Şu değerler geçerli bir tarih ifade etmiyorlar: Yıl %1$s, Ay %2$s, Gün %3$s.Yazı tipi yüzü belirtilen “%d” kimlikli yazı tipi ailesine ait değil.Yazı tipi derlemesinin yazı tipi aileleri.Yazının biçimi.Oluşturulan parola. Yalnızca bir uygulama ekledikten sonra kullanılabilir.Belirtilen nesne kimliği bir menü ögesi değil.Yazının genel benzersiz kimliği."%1$s" tanıtıcısı, kayıtlı olmayan bağımlılıklarla birlikte kuyruğa eklendi: %2$s.Yol tanıtıcısı geçersizYol tanıtıcısı geçersiz.Biçemin insan tarafından okunabilen etiketi.Simge içeriği (SVG işaretlemesi).Yazı türünün simgesi.Simge etiketi.Simge adı.Kayıtlı kenar çubuğunun kimliğiŞablonun kimliğiGörsel zaten istenilen boyutta.Gömülü üst veriler güncellenemediğinden görsel döndürülemedi.Görsel düzenlenmedi. Değişiklikleri uygulamadan önce görseli düzenleyin.Özniteliklerin başlangıç değerleri.Bağlantı metni boş olamaz.Açmaya çalıştığınız bağlantının süresi dolmuş.Örnekte kullanılan iç blokların listesi.Değişikliğin uygulanabileceği kapsamların listesi. Belirtilmediğinde tüm kapsamlar için kullanılacağı varsayılır.Kullanıcı için yerelleştirme dizgesi. Örnek: en_US.Menüye atanan konumlar.Oturum açma sayfası yeni bir pencerede açılır. Oturum açtıktan sonra pencereyi kapatıp bu sayfaya dönebilirsiniz.Kullanıcının oturum açma kullanıcı adı.Piksel cinsinden gömme çerçevesinin en fazla yüksekliği.Piksel cinsinden gömme çerçevesinin en fazla genişliği.Menu kimliği boş olmamalıdır.Menü silinemez.%s menü adı var olan bir menü adı ile aynı. Lütfen başka bir ad kullanın.Belirtilen menü geçerli bir menü değil.Temanın çalışması için gereken en düşük PHP sürümü.Temanın çalışması için gereken en düşük WordPress sürümü.Yazı tipi derlemesinin adı.Adın sitenizde nasıl görüntüleneceği.Uygulama parolasının adı.İç bloğun adı.Menü konumunun adı.Yapılan sınamanın adı.Temanın adı.Adlandıma alanı yalnızca yönerge işlemi sırasında atlanabilir.Durum verisi aktarılırken adlandırma alanı gereklidir.Adlandırma alanı boş olmayan bir metin olmalıdır.Ağ şu anda hem site hem de kullanıcı hesaplarının açılmasına izin veriyor.Ağ şu anda site hesaplarının açılmasına izin veriyor.Ağ şu anda kullanıcı hesaplarının açılmasına izin veriyor.Ağ şu anda hesap açılmasına izin vermiyor.Sonraki biçimleme grubundaki kısayollar siz yazdıkça ya da aynı paragraftaki düz metnin etrafına içerik ekledikçe uygulanırlar. Esc tuşuna basarak ya da geri al tuşu ile geri alabilirsiniz.Kullanıcının takma adı.Aynı yazar tarafından yayınlanan blok sayısı.Değerlendirme sayısı.Bu bloğu etkinleştiren site sayısı.Kullanılacak oEmbed biçimi.İstenilen kaydırma numarası kullanılabilecek sürümlerin sayısına eşit veya daha büyük.Yazının diğer yazılara göre sıralaması.İstenilen sayfa numarası kullanılabilecek sayfa sayısından büyük.Üst terim kimliği.Üst tema eksik. Lütfen "%s" üst temasını kurun.Parola bir boşluk olamaz ya da tümüyle boşluktan oluşamaz.Yorumun üst yazısının parolası (yazı parola ile korunuyorsa).Parola korumalı ise yazının parolası.Model kimliği.Model kategorisi adres son ekleri.Model içeriği.Modelin ayrıntılı açıklaması.Model anahtar sözcükleri.Model adı.Okunabilir biçimde model başlığı.Yerleştirici ön izlemesi için model görüntü alanı genişliği.Modelin kategori adres son ekleri.Modelin anahtar sözcükleri.Geri bağlantı zaten kayıtlı.Eklenti etkinleştirme durumu.Eklenti yazarı.Ekran için biçimlendirilmiş eklenti açıklaması.Eklenti açıklaması.Eklenti dosyası.Bu eklenti için gerekli bir eklenti yok.Eklenti kurulmamış.Eklenti adı.Eklenti sürümü.Eklenti metin alan adı.Eklentinin site adresi.Yazı kimliği 0 değerinden büyük olmalıdır.Yazı silinemez.Yazıların çöpe atılması desteklenmez. Silmek için '%s' olarak ayarlayın.Bu yazı zaten silinmiş.%1$s yazı durumu kayıtlı değil. Yani bu durum için %2$s yetkinliğinin sorgulanması pek güvenilir değil.%1$s yazı türü kaydedilmemiş. Yani bu tür için %2$s yetkinliğinin sorgulanması pek güvenilir değil.Yazı türü değiştirilemeyebilir.Küçük görselleri destekleyen yazı türleri ya da tüm yazı türleri destekleniyorsa doğru.Bir model ön izlenirken bakış açısının yeğlenen genişliği, piksel olarak.Önceki değişiklikler zaten yayınlanmış. Lütfen geçerli ayar değişikliğini yeniden kaydetmeyi deneyin.Belirtilen kopya geçersiz. Ham (raw), kodlanmış (encoded) ya da karma (hash) olmalıdır.Belirtilen kopya bozuk.Yazılan parola geçersiz bir uygulama parolası.Belirtilen bileşen türü (id_base) güncellenemedi.“%s” hizmet sağlayıcısı yapay zeka istemci kayıt defterinde kayıtlı değil.Sorgu bağımsız değişkeni bir dizi ya da etiket adı olmalıdır.%s sorgu değişkeninde bir yer belirticisi olmalı.Sorguda iletilen değişkenler (%2$d) için doğru sayıda yer belirticisi (%1$d) bulunmuyor.Sorguda yalnızca bir yer belirticisi bekleniyordu fakat bir dizi çoklu yer belirticisi gönderilmiş.Ham eklenti açıklaması.İşlenmiş blok.İstenilen yol toplu iş isteklerini desteklemiyor.İstenilen tema bulunamadı.Böyle bir kullanıcı yok.İstenilen bileşen geçersiz.Yetenek uygulamasının sonucu.Sürüm, "%d" kimliğiyle belirtilen üst ögeye ait değil%s rolü bulunamadı.Kullanıcıya atanmış roller."%1$s" tanıtıcılı betik geçersiz olan bir ya da birkaç betik modülü bağımlılığı var ("%2$s")."%1$s" kimliğine sahip komut dosyası modülü, kayıtlı olmayan bağımlılıklarla sıraya alındı: %2$s."%1$s" tanıtıcılı betik, kayıtlı olmayan bağımlılıklarla kuyruğa eklendi: %2$s."%1$s" tanıtıcılı betikte, kayıtlı olmayan betik modülü bağımlılıkları ("%2$s") bulundu: %3$s.Arama sonuçları siz yazdıkça güncellenir.Sunucu görseli işleyemedi. Sunucu meşgulse veya görevi tamamlamak için yeterli kaynağı yoksa bu durum gerçekleşebilir. Daha küçük bir görsel yüklemek yardımcı olabilir. Önerilen en büyük boyut 2560 pikseldir.Bileşenin bulunduğu kenar çubuğu.Bileşenin döneceği kenar çubuğu.Bu tür menü ögelerini tanımlamak için kullanılan tekil etiket.%s sitesi sizin.Site yöneticisinin e-posta adresi.Site yöneticisi bilgilendirildi ve isteğinizi en kısa sürede yerine getirecek.Site yöneticisi bilgilendirildi. İsteğiniz yerine getirildiğinde, e-posta ile kişisel verilerinizi dışa aktarıp indirebileceğiniz bir bağlantı alacaksınız.Site yöneticisi bilgilendirildi. Verilerinizi sildiklerinde bir e-posta onayı alacaksınız.Site zaten başlatılmış gibi görünüyor.Site zaten başlatılmamış gibi görünüyor.Sitenin karakter kodlaması.Sitenin giriş adresi.Site daha önce etkinleştirilmiş.Sitenin dil kodu.Sitenin sloganı.Sitenin başlığı.İstekte bulunduğunuz site düzgün bir şekilde kurulmamış. Lütfen sistem yöneticisi ile görüşün.Açmaya çalıştığınız site, %s, yo. Ama şimdi siz oluşturabilirsiniz!Aradığınız site, %s, bulunamadı.Sitenin altyapı ortamı sınıflandırması (şunlardan biri olabilir: üretim, hazırlık, geliştirme, yerel).&#8220;%s&#8221; adres son eki başka bir terim tarafından kullanılıyor.Alternatifi getirilecek şablonun adres son ekiKaynak adresi ve hedef adres aynı kaynağı gösteremez.Kaynak adresinde, hedef adresin bağlantısı yok. Bu yüzden kaynak olarak kullanılamıyor.Kaynak adresi bulunamadı.Belirtilen manifest dosyası bulunamadı.Belirtilen adlandırma alanı bulunamadı.Belirtilen adres hedef olarak kullanılamaz. Böyle bir adres yok ya da ilgili adres geri bağlantıların etkin olduğu bir kaynak değil.Belirlenmiş hedef adresi bulunamadı.Bloğun yıldız değerlendirmesi.Sınamanın durumu."%1$s" tanıtıcılı biçem, kayıtlı olmayan bağımlılıklarla sıraya alındı: %2$s.Etiket bulutu bileşenini destekleyen sınıflandırma olmadığı için etiket bulutu görüntülenmeyecek.Bu menü ögesi için bağlantı bileşeninin hedef özniteliği.Şablon silinemez.Şablon zaten silinmiş.Oluşturulan şablonun şablon ön eki. Bu ön ek, ana şablon türünü ayıklamak için kullanılır, örneğin `taxonomy-books` için `taxonomy` ayıklanırYazı türü ile ilişkilendirilmiş template_lock değeri, veya değer yoksa false mantıksal ifadesiTerim silinemez.Terim adı boş olamaz.%s sınıflandırmasındaki nesneye atanmış terimler.%s sınıflandırmasındaki yazıya atanmış terimler.Tema üst bilgisinde bulunan tema geliştiricisinin adı.Tema geliştiricisi.Bu tema kendisini kendisinin üst teması olarak tanımlıyor. Lütfen %s üst bilgisini kontrol edin.Tema üst bilgisinde bulunan tema açıklaması.Temanın görüntülenmek üzere dönüştürülmüş açıklaması."%s" tema klasörü bulunamadı.Yazıyı görüntülemek için kullanılan tema dosyası.Tema belirteciTema üst bilgisinde bulunan tema adı.Temanın görüntülenmek üzere dönüştürülmüş adı.Tema üst bilgisinde bulunan tema kod imleri.Temanın görüntülenmek üzere dönüştürülmüş etiketleri.Temanın geçerli sürümü.Temanın ekran görüntüsü adresi.Temanın biçem sayfası. Bu dosya, temayı benzersiz bir şekilde tanımlar.Temanın şablonu. Bu bir alt tema ise, ana temaya başvurur. Yoksa bu temanın biçem sayfası ile aynıdır.Temanın metin alanı.Yazdığınız saat dilimi geçerli değil. Lütfen geçerli bir saat dilimi seçin.Nesnenin başlığı.Yazı türünün başlığı.Yazının başlığı.Durum için başlık.Sınıflandırmanın başlığı.Bir özel menü ögesi türü kullanılırken başlık yazılmalıdır."Kategori", "yazı" ya da "ek dosya" gibi özgün olarak sunulan nesnenin türü.Bileşen türü. Bileşen türü uç noktalarının kimliğine karşılık gelir.Eşsiz ve makine tarafından okunabilen ad.Gezinme menüsünün benzersiz kimliği.Uygulama parolasının benzersiz kimliği.Temanın biçem klasörünün adresi.Tema şablon klasörünün adresi. Bu bir alt tema ise üst temayı gösterir. Diğer durumda tema biçem klasörü ile aynıdır.Bir özel menü ögesi türü kullanılırken adres yazılmalıdır.Kullanıcı kimliği.Kullanıcı silinemez.Bu kullanıcı zaten etkin.Yeni bir kullanıcı oluştururken user_pass alanı zorunludur. Kullanıcı oturum açmadan önce parolasını sıfırlamalıdır."%s" değeri bir kurgu kuralı için geçerli bir kimlik değil."%s" bir kurgu kuralı için geçerli bir isteklilik değeri değil."%s" değeri bir kurgu için geçerli bir kaynak değil."%s" değeri geçerli bir kurgu kuralları kipi değil."%2$s" betiği için "%1$s" değeri bir dizi olmalıdır.Bu yazı türünün görünürlük seçeneği.Sınıflandırmanın görünürlük ayarları.Cihazınızdaki tarayıcı dosya yüklemek için kullanılamıyor. Bunun yerine cihazınız için geliştirilmiş <a href="%s">uygulamayı</a> kullanabilirsiniz.Site sunucusu bu görüntü için uyumlu görsel boyutları oluşturamadı. Yüklemeden önce JPEG veya PNG biçimine dönüştürün.Tema üst bilgisinde bulunan tema geliştiricisinin site adresi.Tema geliştiricisinin görüntülenmek üzere dönüştürülmüş sitesi.Tema geliştiricisinin site adresi.Bileşen türü kimliği.TemaTema bilgileriTema dosyası var.Şablonun tema kimliği.Tema bulunamadı.123 Ana caddeBir giriş sayfası bölümüHakkımızdaBu site hakkındaAdresArşivlerBlogTakvimKategorilerBize ulaşınE-postaFacebookKonumumuzFoursquareGitHubGirişSaatlerInstagramLinkedInÜst veriPazartesi&ndash;Cuma: 9:00&ndash;17:00İstanbul, 34000HaberlerPinterestSon yorumlarSon yazılarCumartesi ve Pazar: 11:00&ndash;15:00Site aramasıBu sayfada, adres ve telefon numarası gibi temel iletişim bilgileri bulunur. Ayrıca bir iletişim formu eklemek için bir eklenti de deneyebilirsiniz.Bu örnek bir giriş sayfası bölümüdür. Giriş sayfası bölümleri giriş sayfasının dışında herhangi bir sayfa olabilir. Son blog yazılarınızı görüntüleyen sayfa ile birlikte.Burası kendinizi ya da sitenizi tanıtmak, ya da emeği geçenlerden bahsetmek için iyi bir yer olabilir.TwitterSitenize hoş geldiniz! Burası sizin giriş sayfanızdır. Ziyaretçilerinizin çoğu sitenize geldiğinde ilk olarak bu sayfayı görür.YelpKendini ve işlerini tanıtmak isteyen bir sanatçı olabileceğiniz gibi misyonunu açıklamak isteyen bir firma da olabilirsiniz.YouTube%1$s tema desteği %2$s kancasından önce kayıt edilmelidir.%s olmayan temaTemalarİstenilen isteği karşılayabilecek HTTP taşıyıcısı olmadığından istek tamamlanamadı.İlişkilendirilmiş bir alt yazı yok.Bu bileşenin herhangi bir seçeneği yok.Yeni bir e-posta yok gibi görünüyor.Bir %s dosyası yok gibi görünüyor. Kurulumu sürdürebilmek için bu dosya gereklidir.Sitenizde ciddi bir sorun çıktı ve kurtarma kipine geçildi. Lütfen ayrıntılı bilgi almak için temalar ve eklentiler bölümlerine bakın. Bir temayı veya eklentiyi yeni kurduysanız ya da güncellediyseniz, önce bununla ilgili bölüme bakın.Sitenizde ciddi bir sorun çıktı.Bu sitede ciddi bir sorun çıktı. Lütfen yönergeler için site yöneticisinin gelen kutusuna bakın. Sorun sürerse, lütfen <a href="%s">destek forumlarını</a> deneyin.Bu sitede ciddi bir sorun çıktı. Lütfen site yöneticinizle görüşün ve yardım almak için bu sorunu bildirin.Görsel kırpılırken bir sorun çıktı.Kaydetmeden önce düzeltmeniz gereken %d sorun var.Kaydetmeden önce düzeltmeniz gereken %d sorun var.Ön izlemesini görüntülediğinizden daha güncel, otomatik kaydedilmiş değişiklikler var. <a href="%s">Otomatik kaydedilmiş sürümü geri yükle</a>%s için yeni bir sürüm yayınlanmış ancak sizin PHP sürümünüzle çalışmıyor.%s için yeni bir sürüm yayınlanmış ancak sizin WordPress sürümünüzle çalışmıyor.%s için yeni bir sürüm yayınlanmış ancak sizin WordPress ve PHP sürümlerinizle çalışmıyor.Bu yazının daha güncel bir sürümü var.Bu yazı için zaten bu adresten gelen bir geri bağlantı var.Bu yazının otomatik kaydedilmiş bir sürümü yok.Bu şablon için otomatik kayıt sürümü bulunmuyor.Burada alıntı yok çünkü bu yazı korumalı.Bir yapılandırma hatası var. Lütfen sunucu yöneticinizle görüşün.Bir sorun çıktı. Lütfen aşağıdaki formu düzeltip yeniden deneyin.Bir kimlik doğrulama sorunu çıktı. Lütfen sayfayı yenileyip yeniden deneyin.Henüz burada görüntülenecek bir içerik yok.Gereksinimleri geçersiz olduğundan bu eklentiler etkinleştirilemez. Bu XML site haritası, içeriğinizi arama motorları için daha görünür kılmak amacıyla WordPress tarafından oluşturulur.Bu işlem yönetici tarafından etkisizleştirilmiş.Bu adres, yeni kullanıcı bildirimleri gibi yönetim işlemleri için kullanılır.Diğer zamanlı fonksiyonların davranışları ile örtüşmesi için argüman bir diziye çevrildi.Bu blok, bu haritanın anahtarları olarak kullanılan blok türlerinin yanında, karşılık gelen değer tarafından verilen ilgili konuma otomatik olarak eklenir.İçerik parola korumalı.Bu içerik parola ile korunuyor. Görüntülemek için lütfen aşağıya parolanızı yazın.Bu içerik yazar tarafından silindi.Ya %1$s dosyasındaki kullanıcı adı ve parola bilgileriniz yanlış ya da %2$s konumundaki veri tabanı sunucusu ile bağlantı kurulamıyor. Veri tabanı sunucunuz çalışmıyor olabilir.Bu e-posta kişisel e-posta adresinizden farklı olabilir.Bu özellik iç çerçevelere gerek duyar. Tarayıcınızın iç çerçeveler özelliği kapatılmış ya da tarayıcınız bu özelliği  desteklemiyor.Bu dosya site sunucusu tarafından işlenemedi.Bu dosya boş. Lütfen başka bir tane deneyin.Bu dosya bir görsel değil. Lütfen başka bir dosya deneyin.Bu dosya SimplePie 1.2.x sürümleri ile geriye dönük uyumluluk için yüklendi. Lütfen daha güncel bir SimplePie sürümüne geçmeyi düşünün.Bu dosya çok büyük. Dosyalar %s KB boyutundan küçük olmalı.Bu dosyanın artık katılması gerekmiyor.Bu form canlı ön izlenemez.Bu işlev, tema dizini kaydedilmeden önce çağrılmamalıdır.Bu görsel bir tarayıcıda görüntülenemez. En iyi sonucu almak için yüklemeden önce JPEG biçimine dönüştürün.Bu dosya olabilecek en büyük boyutu aşıyor. Lütfen başka bir dosya deneyin.Bu kısa bağlantıdır.Bu bağlantı canlı ön izlenemez.Bu durum %s konumundaki veri tabanı sunucusu ile bağlantıyı kaybettiğimiz anlamına geliyor. Veri tabanı sunucunuz çalışmıyor olabilir.Bu bildirim %s tanıtıcısı tarafından tetiklendi.Şablon boş olduğu için bu sayfa boş. Site düzenleyicisinden sıfırlayabilir veya özelleştirebilirsiniz.Bu pano sitenizde yayınlanmış içeriklerin gezinme menüsünü yönetmek için kullanılır. Sayfalar, yazılar, kategoriler, etiketler, biçimler ve özel bağlantılar ile menüler oluşturabilirsiniz.Bu parola sıfırlama talebi %s IP adresinden geldi.Bu kişisel veri isteğinin süresi dolmuş.Bu yazı parola ile korunuyor. Yorumları görüntülemek için parolayı yazın.Bu kaynak site barındırma hizmetiniz tarafından sunulmakta olup, sitenize özgüdür. Ayrıntılı bilgi almak için, <a href="%s" target="_blank">resmi WordPress belgelerine bakabilirsiniz</a>.Bu site, %s MIME türündeki ek dosyalarına küçük görsel eklenmesini desteklemiyor.Bu site arşivlenmiş ya da askıya alınmış.Site henüz etkinleştirilmemiş. Sitenizi etkinleştirme sorunları yaşıyorsanız lütfen %s ile görüşün.Bu site artık kullanılamıyor.Sınıflandırma hiyerarşik değil.Bu tema bu sayfada video üst bilgilerini desteklemiyor. Ön sayfaya ya da videolu üst bilgiyi destekleyen başka bir sayfaya gidin.Bu tema sizin PHP sürümünüzle çalışmaz.Bu tema sizin WordPress sürümünüzle çalışmaz.Bu tema sizin WordPress ve PHP sürümlerinizle çalışmaz.Bu tema özelleştiriciyi desteklemiyor.Bu tema düzgün yüklenemedi ve yönetim bölümünde duraklatıldı.Bu dosya türü düzenlenemez.Hatalı karakterler kullanıldığından bu kullanıcı adı geçersiz. Lütfen geçerli bir kullanıcı adı yazın.Bu video dosyası üst bilgide kullanmak için çok büyük. 8MB boyutundan küçük olacak şekilde daha kısa bir video dosyasını ya da video sıkıştırma ayarını değiştirerek aynı dosyayı yeniden yüklemeyi deneyebilirsiniz. Ayrıca videoyu YoutuTube üzerine yükleyerek aşağıdaki seçenekten bağlayabilirsiniz.Bu bileşende &#8220;Özel HTML&#8221; bileşeninde daha iyi çalışabilecek kodlar bulunuyor. Bu bileşeni denemeye ne dersiniz?Bu bileşende &#8220;Özel HTML&#8221; bileşeni ile daha uyumlu çalışacak kodlar bulunuyor olabilir. Henüz denemediyseniz, Özel HTML bileşenini denemeye ne dersiniz?PerKüçük görselKüçük görsel yüksekliğiKüçük görsel genişliğiPerşembePZamanSaat biçimiZaman ayarıSaat dilimiBirkaç bağlantı ekleme zamanı! &#8220;%s&#8221; üzerine tıklayarak, menünüze sayfalar, kategoriler ve özel bağlantılar ekleyin. İstediğiniz kadar şey ekleyebilirsiniz.BloklarBiçimlerBaşlıklarŞablon ekleŞablonlarDüzenleDosyaBiçimEkleTabloAraçlarGörünümBaşlıkBaşlık özniteliğiGenel biçem çeşitleri başlığı. Veri tabanındaki ile aynı.Nesnenin başlığı, veri tabanında olduğu gibi.Yazının başlığı, veri tabanında olduğu gibi.Şablonun başlığı, veri tabanında olduğu gibi.Bileşenin başlığıGezinmeBlok türünün başlığı.Şablonun başlığı.Genel biçem çeşidinin başlığı.Başlık:Sitenizi etkinleştirmek için, aşağıdaki bağlantıya tıklayın:

%1$s

Etkinleştirdikten sonra, oturum açma bilgilerinizin bulunduğu *başka bir e-posta* alacaksınız.

Etkinleştirdikten sonra blogunuza şuradan erişebilirsiniz:

%2$sKullanıcınızı etkinleştirmek için, lütfen aşağıdaki bağlantıya tıklayın:

%s

Etkinleştirdikten sonra, oturum açma bilgilerinizin bulunduğu *başka bir eposta* alacaksınız.Hesap açma değişikliği yapmak ya da izin vermemek için <a href="%s">Ayarlar sayfasına</a> gidin.Bu alandan ayrılmak için Esc tuşuna ve ardından Tab tuşuna basın.Odağı diğer tuşlara taşımak için sekme ya da ok tuşlarını kullanın. Düzenleyiciye yeniden odaklanmak için ESC ya da tuşlardan birini kullanın.Parolanızı sıfırlamak için, şu adrese gidin:Parolanızı belirlemek için, şu adrese gidin:BugünYazı düzenleyicisinin metin yönünü değiştirBelirteç haritası belirteçleri ve yedeklerinin tümü %1$d bayttan küçük olmalıdır.Çok fazla yer imi var: Daha fazla yer imi oluşturulamaz.seek() işlevine çok fazla çağrı yapılması performans sorunlarına yol açabilir.Çok fazla yönlendirme.Araç çubuğuAraç çubuğunu aç/kapatAraçlarÜstSol üstSağ üstGeri izlemeGeri izleme özeti: Yardımcı kayıtlar (alt yazı, başlık, açıklama, bölüm veya üst veriler)Çeviri güncellemeleri%1$s alan adı için çeviri yüklemesi çok erken tetiklendi. Bu genellikle eklenti veya temadaki bazı kodların çok erken çalıştığının bir göstergesidir. Çeviriler %2$s eyleminde veya daha sonra yüklenmelidir.Çöp <span class="count">(%s)</span>Çöp <span class="count">(%s)</span>Çöpe at: %sSalSalıSTürkçeGünde iki kezTürBir blok seçmek için / yazınTerimin atıfını yazın.Yazının türü.Şablon türü.Yorum türü.Sınıflandırmayla ilişkilendirilmiş türler.AdresYazar yorumunun adresi.Adres bulunamadı. Bu adres için dönen durum kodu 200 değildi.Terimin adresi.Kullanıcının adresi.Yazı tipi yüzünün ön izleme görselinin adresi.Yazı tipi ailesinin ön izleme görselinin adresi.%s ses kaynak dosyasının adresi%s video kaynak dosyasının adresiYorum adresi.Düzenlenen görsel dosyasının bağlantısı.Ortam dosyasının adresiNesnenin adresi.Özgün ek dosyanın adresi.Yazının adresi.Bileşen yönetici formundan adres kodlu form verileri. Kopyalamayı desteklemeyen bir pencere ögesini güncellemek için kullanılır. Yalnızca yazılabilir.Adres: %sUTCUkraynacaDosya sistemi ile bağlantı kurulamadı. Lütfen kimlik doğrulama bilgilerinizi kontrol edin.Klasik menü bloklara dönüştürülemez.%s klasörü oluşturulamadı. Bir üst klasöre sunucu tarafından yazılabiliyor mu?Görsel kırpılamadı.Hangi eklentinin kurulu olduğu belirlenemiyor.Bu görsel düzenlenemiyor.Bu görsel çevrilemedi.Dosyanın üst veri bilgileri alınamadı.WordPress içerik klasörünün (%s) konumu bulunamadı.Dışarıya aktarılan (arşiv) dosyası yazılmak üzere açılamadı.Çoklu site kullanılmıyorsa %s ağına geçilemez.Bilinmeyen bir sorundan dolayı ortam ön izlemesi görüntülenemiyor."%3$s" biçem sayfasının "%2$s" değerindeki "%1$s" anahtarı okunamadı.Bu adresteki yanıtın gövde bölümü alınamadı.Veri tabanı sunucusundan hata iletisi alınamadıGörsel döndürülemedi.%s geçersiz ayar nedeniyle kaydedilemedi.%s geçersiz ayar nedeniyle kaydedilemedi.Kişisel verileri dışa aktarma onayı e-postası gönderilemedi.Satır içi betik verileri ayarlanamadı.Form gönderilemedi. Lütfen bir süre sonra yeniden deneyin.Değişiklikler çöpe atılamadı.OnaylanmamışYetkinliklere göre ayar değiştirme izni yok.Yetkisiz. Ön yüz olarak ön izlemek için %s parametresini kaldırabilirsiniz.GenelYakalanamayan "%s" atıldı:"%2$s" adlandırma alanında ve"%1$s" yolunda türetilmiş bir durum çağrısı yürütülürken yakalanamayan hataDeğişmemiş:%s altınaAltı çizgiliGeri alKodlanmamış kopya ayarları, destekleniyorsa.Sunucu beklenmeyen bir yanıt verdi. Dosya yüklenmiş olabilir. Ortam kitaplığına bakın ya da sayfayı yeniden yükleyin.Yetenek kategorisinin benzersiz kimliği.Yeteneğin benzersiz kimliği.Ek dosyanın eşsiz kimliği.Yorumun eşsiz belirteci.Yazı tipi derlemesinin eşsiz belirteci.Yazı tipi yüzünün eşsiz belirteci.Genel biçem sürümün benzersiz kodu.Nesnenin benzersiz kimliği.Yazının eşsiz belirteci.Sürümün eşsiz kodu.Terim için benzersiz tanımlayıcı.Kullanıcının benzersiz kimliği.Bileşen için benzersiz tanımlayıcı.Blok türünü tanımlayan benzersiz ad.Kenar çubuğunu tanımlayan benzersiz ad.Biçemi tanımlayan benzersiz ad.Bloğun benzersiz kayıtlı adı.Şablonu belirten eşsiz adres son eki.Bileşen türünü belirten eşsiz adres son eki.Bilinmeyen akışYazar bilinmiyorBilinmeyen yer imi adı.E-posta adresi bilinmiyor. Yeniden denetleyin ya da kullanıcı adınızla deneyin.Kodlama bilinmiyor: Sesi açBilinmeyen arka plan ayarı.%1$s parametresinde tanınmayan anahtar(lar) var: %2$s. Desteklenen anahtarlar: %3$sBir iç yazı türünün kaldırılmasına izin verilmezİç sınıflandırmanın kaldırılmasına izin verilmiyor.Bu karma algoritması desteklenmiyor: %1$s. Desteklenen algoritmalar şunlardır: %2$sDeğer türü geçersiz (%s).BaşlıksızBaşlıksız yazı %dGüncelleKategoriyi güncelleBağlantı kategorisi adını güncellePHP sürümünü güncelleModel kategorisini güncelleEtiketi güncelleSitenizi bozma olasılığına rağmen yine de güncellensin mi?Ses oynatma listesini güncelleGaleriyi güncelleŞimdi güncelleVideo listeini güncelleGüncelleniyorYorum güncellenemedi.Yorum durumu güncellenemedi.Yükleme sınırı aşıldıYüklenemedi.Dosya yükleGörselleri yükleYükleme durdu.En iyi sonucu almak için videonuzu %1$s biçiminde ve boyutunu küçülterek yükleyin. Temanız için %2$s piksel yüksekliği öneriliyor.En iyi sonucu almak için videonuzu %1$s biçiminde ve boyutunu küçülterek yükleyin. Temanız için %2$s piksel genişliği öneriliyor.En iyi sonucu almak için videonuzu %1$s  biçiminde ve boyutunu küçülterek yükleyin. Temanız için %2$s piksel boyutu öneriliyor.Yükleyen:Yüklenme tarihi:Bu gezinme menüsüne yüklendiBu sayfaya yüklenmişBu yazıya yüklenmişBu şablona yüklenmişBu şablon parçasına yüklenmişYüklendiği yer:ya daYükleniyorErişilebilirlik özellikleri için oturum açma logosunda başlık özniteliğinin kullanılması önerilmez. Bunun yerine bağlantı metnini kullanın.Kullanıcı düzeyleri kullanımdan kaldırıldı. Bunun yerine yetkinlikleri kullanın.Değerin ekranda görüntülenmesini istemiyorsanız %s kullanın.Yerine %s kullanın.Sol/sağ tuşları ile bir saniye, yukarı/aşağı tuşları ile 10 saniye ileri/geri atlayın.Site düzenleyiciyi kullanYukarı/aşağı tuşları ile sesi artırın ya da azaltın.`pre_render_block` ile süzgeç kullanımdan kaldırıldı. Bunun yerine `render_block_data` ile kullanın.Katılmayacak terimleri ayırmak için virgül yerine %s kullanın.Yerine %s süzgecini kullanın.Bileşen alanlarınıza isteğe bağlı HTML kodu eklemek için özel HTML bileşenini kullanın.Daha duruma özgü bir şablon tanımlanmadığında tüm sayfalar için alternatif şablon olarak kullanılır.Şu şekilde kullanılır:KullanıcıKullanıcı uygulamasıKullanıcı Başlangıç ekranı: %sKullanıcının açıklamasıKullanıcının görüntülenecek adıKullanıcının e-posta adresiKullanıcının adıKullanıcı kimliğiKullanıcının soyadıKullanıcının kullanıcı adıKullanıcının güzel adıKullanıcının takma adıKullanıcının hesap açma tarihiKullanıcının isteğiKullanıcının istekleriKullanıcının adresiKullanıcı adresi 100 karakterden uzun olamaz.İşlem onaylandı.Yorum yazarının kullanıcı uygulaması (tarayıcı/işletim sistemi).Kullanıcı bu siteye eklenemez.Kullanıcı hatası tetiklendi:Kullanıcı, HTTP üzerinden %s adresine yapılan istekleri engelledi.Kullanıcı sorguları, %s kancasından önce çalıştırılmamalıdır.Kullanıcı hesabı açılmasına izin verilmiyor.YöneticiYazarKatılımcıEditörAboneKullanıcının oturum belirteçleri verileri.Kullanıcının yorum verileri.Kullanıcının konum verisi WordPress etkinlikleri ve haberler, Başlangıç ekranı bileşenindeki topluluk etkinlikleri için kullanılır.Kullanıcının ortam verileri.Kullanıcının profil verileri.Kullanıcı adıKullanıcı adı düzenlenemez.Kullanıcı adı 60 karakterden uzun olamaz.Kullanıcı adı en az 4 karakter uzunluğunda olmalıdır.Kullanıcı adı ya da e-posta adresiKullanıcı adı:Kullanıcı adı: %sKullanıcı adlarında yalnızca küçük harfler (a-z) ve rakamlar bulunabilir.KullanıcılarKullanıcıların çöpe atılması desteklenmez. Silmek için '%s' olarak ayarlayın.Basitleştirilmiş adres işleyici kullanmanız önerilmez. Tam RFC822 işlemesi için PHP IMAP eklentisini kurun.DeğerGirdi dizisinin değerleri ya nesne ya da dizi olmalıdır.SürümBlok API sürümü.Yazı tarafından kullanılan içerik bloğu biçiminin sürümü.Şablon tarafından kullanılan içerik bloğu biçiminin sürümü.Yazı görünümü ayarları için kullanılan theme.json şemasının sürümü.Kırpmaya, görsel yüksekliğinin bir yüzdesi olarak başlamak için üstten dikey konum.Dikey boşlukVideoVideo <span class="count">(%s)</span>Video <span class="count">(%s)</span>Video oynatıcıVideo bileşeniVideo bileşeni (%d)Video bileşeni (%d)Video bilgileriVideo durduruldu.Video oynatılıyor.Video başlığıVideo başlığı&hellip;VietnamcaGörüntüleEk dosya sayfasını görüntüleKategoriyi görüntüleDeğişim kümesini görüntüleOrtam dosyasını görüntüleGezinme menüsünü görüntüleSayfayı görüntüleSayfaları görüntüleModeli görüntüleModel kategorisini görüntüleModelleri görüntüleYazıyı görüntüleYazıları görüntüleEtiketi görüntüleŞablonu görüntüleŞablon parçalarını görüntüleKullanıcıyı görüntüleEk dosya sayfasını görüntüleOrtam dosyasını görüntüleYazıyı görüntüleGörünürlük:Görünür%s sitesine gidinSiteyi görüntüleGörsel destekSes ayarıBir süre daha bekleyin. Bazen kontrolümüz dışında gelişen olaylar nedeniyle e-postaların teslim edilmesi gecikebiliyor.Uyarı: %1$s, %2$s (%3$s) parametresinin %4$s olarak verilmesini bekliyor, %5$s verildi.Uyarı: Bağlantı eklendi fakat sorun olabilir. Lütfen deneyin.Webfont yazı tipi ailesi boş olmayan bir dizge olmalıdır.Webfont yazı koyuluğu uygun biçimlendirilmiş bir dizge ya da tam sayı olmalıdır.Webfont src değeri boş olmayan bir dizge ya da dizge dizisi olmalıdır.İnternet sitesiSite: %1$s (IP adresi: %2$s, %3$s)ÇarÇarşambaÇYeniden hoş geldiniz, %s. Aşağıdaki formu doldurarak <strong>hesabınıza başka bir site ekleyebilirsiniz</strong>. Sınırsız sayıda site eklenebilir. İstediğiniz kadar site oluşturun ama yazarken sağduyulu olun!Galler DiliŞimdi ne yapacağım?Ön sayfada görüntülenecekler%s yetkinliğini kontrol ederken, her zaman belirli bir yorum için kontrol etmeniz gerekir.%s yetkinliğini kontrol ederken, her zaman belirli bir sayfa için kontrol etmeniz gerekir.%s yetkinliğini kontrol ederken, her zaman belirli bir yazı için kontrol etmeniz gerekir.%s yetkinliğini kontrol ederken, her zaman belirli bir terim için kontrol etmeniz gerekir.%s yetkinliğini kontrol ederken, her zaman belirli bir kullanıcı için kontrol etmeniz gerekir.Yeniden sıralama kipinde üstteki ögeler listesinde yeniden sıralama ile ilgili yeni ögeler kullanılabilir olur.Yeniden sıralama kipinde aşağıdaki listedeki bileşenlerin sıralamasını değiştirmek için ek denetimler görüntülenir."Variadic" tema özelliği kaydedilirken, "type" bir "dizi" olmalıdır.Bir varsayılan üst veri değeri kaydedilirken, veri belirtilen tür ile eşleşmelidir.Bir "dizi" özelliği kaydedilirken, özelliğin şemasında "items" anahtar sözcüğü bulunmalıdır.REST API içinde gösterilmek üzere bir "array" üst veri türü kaydederken, "show_in_rest.schema.items" içinde her bir array ögesi için şemayı belirtmelisiniz.REST API ile gösterilmek üzere bir "dizi" veya "nesne" özelliği kaydedilirken, özelliğin şeması da tanımlanmalıdır.REST API içinde görüntülenmek üzere bir "array" ayarına kaydedilirken, "show_in_rest.schema.items" içinde her bir array ögesi için şemayı belirtmeniz gerekir.Bir "nesne" özelliği kaydedilirken, özelliğin şemasında "properties" anahtar sözcüğü bulunmalıdır.Yeni bir paragrafa başlarken bu biçim kısayollarından birinin ardından boşluk karakteri gelir, biçim otomatik uygulanır. Silme ya da Esc tuşuna basarak geri alabilirsiniz.%1$s argümanı sağlandığında, “%2$s” betiği ya alt bilgide yazdırılmalı (%3$s true olarak ayarlanmalı) ya da ertelenmiş yükleme %4$s (%5$s) kullanmalıdır; böylece içe aktarma haritası, betik değerlendirilmeden önce yazdırılır.Gezinmek için bir klavye kullanırken:%1$s sabitini kullanırken, bu genel değişkenleri bir diziye ayarladığınızdan emin olun: %2$s.Modelin nereden geldiği, örneğin çekirdekŞablonun özgün kaynağı. Örnek: 'theme'Şablon parçasının kullanılması amaçlanan yer (üst bilgi, alt bilgi gibi)Bir sınıflandırmanın yönetim bölümünde ya da ön yüzde herkese açık olarak kullanılıp kullanılamayacağı.Şablonun özel şablon olup olmadığı.Bir temanın blok temelli şablon parçaları kullanıp kullanmadığı.Bir temanın blok temelli şablonlar kullanıp kullanmadığı.Ögelerin tüm terimlere mi, belirli terimlere mi atanacağı.Yazının yorumlara açık olup olmadığı.Yazıya geri bağlantı verilip verilemeyeceği.Yazının sabit olarak kabul edilip edilmeyeceği.Yazı türünün görüntülenip görüntülenmeyeceği.Yazı türünün alt türü olmasının gerekip gerekmediği.Sınıflandırmanın, alt sınıflandırmasının olup olamayacağı.Terim bulutunun görüntülenip görüntülenmeyeceği.Başlığa yazı ve yorumların RSS akışı bağlantılarının eklenip eklenmeyeceği.Bu durumdaki yazıların yayınlanma tarihlerinin saat dilimi belirsiz olabilir.Durumu bu olan yazıların sitenin ön yüzünde görüntülenip görüntülenmeyeceği.Durumu bu olan yazıların özel olup olmayacağı.Durumu bu olan yazıların korunup korunmayacağı.Durumu bu olan yazıların herkes tarafından sorgulanıp sorgulanamayacağı.İçeriğin bir parola ile korunup korunmadığı.Özetin bir parola ile korunup korunmadığı.Menü ögesinin artık var olmayan bir nesneyi gösterip göstermediği.Eklentinin yalnızca ağ genelinde etkinleştirilip etkinleştirilemeyeceği.Sınıflandırmanın herkese açık olarak sorgulanabilirliği.Temanın document title kod imini yönetip yönetemeyeceği.Temanın özel renkleri etkisiz bırakıp bırakmayacağı.Temanın özel yazı tipi boyutlarını etkisiz bırakıp bırakmayacağı.Temanın özel değişimleri etkisiz bırakıp bırakmayacağı.Temanın oluşturulan yerleşim biçemlerini etkisiz bırakıp bırakmadığı.Temanın bileşenler için seçiçi yenilemeyi özelleştirici tarafından etkinleştirip etkinleştirmeyeceği.Temanın blok temelli bir tema olup olmadığı.Temanın uyumlu gömülü içeriği destekleme durumu.Bileşenin birkaç kopya destekleyip desteklemediğiTemanın görüntülenmek üzere varsayılan WordPress blok biçemlerine katılıp katılmayacağı.Temanın koyu düzenleyici biçemi kullanıcı arayüzüne katılıp katılmayacağı.Temanın CSS kapsayıcısı düzenleyici biçemlerine katılıp katılmayacağı.Temanın geniş hizalama CSS sınıfına katılıp katılmayacağı.İlgili yazı-türler tablosunda sınıflandırma sütunlarının otomatik oluşturulmasına izin verilip verilmeyeceği.Üst düzey sayfaların bu menüye otomatik olarak eklenip eklenmeyeceği.Çöpe atmadan silmeye zorlanıp zorlanmayacağı.Yatay yönde çevrilip çevrilmeyeceği.Dikey yönde çevrilip çevrilmeyeceği.Bileşen kaldırılacak mı, yoksa etkin olmayan kenar çubuğuna mı taşınacak.Bu yazı türünü yönetmek için varsayılan bir kullanıcı arayüzü oluşturulup oluşturulmayacağı.Bu sınıflandırmanın yönetimi için varsayılan kullanıcı arayüzününü oluşturulup oluşturulmayacağı.Herhangi bir yazıya atanmış terimlerin gizlenip gizlenmeyeceği.Sabit yazıların yok sayılıp sayılmayacağı.Sonuç kümesini sınırlandıran terimlere alt terimlerin katılıp katılmayacağı.Yazıların türlerine göre düzenleme listesine katılıp katılmayacağı.Bu yazı türünün gezinme menülerinde seçim için kullanılıp kullanılamayacağı.Gezinme menülerinde sınıflandırma seçiminin kullanılabilirliği.Onaylanmamış hizmet sağlayıcılar için oEmbed keşif isteği yapılıp yapılmayacağı.Hızlı/toplu düzenleme panosunda sınıflandırmanın görüntülenip görüntülenmeyeceği.Yeni bir temayı ön izlerken bileşenler ve menüler gibi konuları uyarlamayı sürdürebilir ve temaya özgü seçenekleri keşfedebilirsiniz.BeyazBu neden önemli?Bileşen aşağı taşındıBileşen yukarı taşındıBileşen türü (id_base) zorunludur.Bileşen türü ham kopyaları desteklemiyor.BileşenlerBileşenler temanız tarafından sunulan (genellikle kenar çubuklarında) bileşen alanlarında yer alan bağımsız içerik alanlarıdır.Bileşenler görüntülenmeden önce, %s kullanarak kaydedilmelidir.GenişlikGörsel genişliğinin yüzdesi olarak kırpmanın genişliği.wordsWordPress &rsaquo; HataWordPress &rsaquo; BaşarılıWordPress adresi (URL)WordPress yorumlarıWordPress gömmeWordPress ortamıWordPress kullanıcısıWordPress veri tabanı sorunu:WordPress veri tabanı hatası: Sorgu, içinde geçersiz veriler bulunduğundan işlenemedi.WordPress veri tabanı hatası: Şu alan işlenemedi: %s. Gönderilen değerde çok uzun veya geçersiz veriler bulunuyor olabilir.WordPress veri tabanı hatası: Şu alanlar işlenenemedi: %s. Gönderilen değerlerde çok uzun veya geçersiz veriler bulunuyor olabilir.WordPress yerel kodu.WordPress %s sürümüWordPress.orgWordPress.org eklenti dizini adres son eki.WordPress.org temalarıSözcük sayısı: %sXML site haritasıXML-RPC servisleri bu site için kapalı.d.m.YYılSarıEvetEskenazi DiliZaten WordPress kurmuşsunuz gibi görünüyor. Yeniden kurmak için lütfen önce eski veri tabanı tablolarınızı temizleyin.Bu ögeleri sitenizden kalıcı olarak silmek üzeresiniz.
Bu işlem geri alınamaz.
 Durdurmak için 'İptal', silmek için 'Tamam' üzerine tıklayın.Bu ögeyi sitenizden kalıcı olarak silmek üzeresiniz.
Bu işlem geri alınamaz.
 Durdurmak için 'İptal', silmek için 'Tamam' üzerine tıklayın.Bu ögeleri çöpe atmak üzeresiniz
 Vazgeçmek için 'İptal', silmek için 'Tamam' üzerine tıklayın.%s sisteminden çıkış yapıyorsunuzŞu an göz attığınız: %sŞu anda %1$s blog arşivinde %2$s ayının kayıtlarına bakıyorsunuz.Şu anda %1$s blog arşivinde %2$s gününün kayıtlarına bakıyorsunuz.Şu anda %1$s blog arşivinde %2$s yılının kayıtlarına bakıyorsunuz.Şu anda %s blog arşivine bakıyorsunuz.%s kategorisi için blog arşivini geziyorsunuz.%s sitesini özelleştiriyorsunuzZaten oturum açmışsınız. Hesap açmanız gerekmiyor!Henüz oturum açmamışsınız.Çıkış yaptınız.Çok hızlı yorum gönderiyorsunuz. Biraz yavaşlayın.Flash oynatıcının etkin ya da kurulmamış olduğu bir tarayıcı kullanıyorsunuz. Lütfen Flash oynatıcı eklentinizi açın ya da son sürümü https://get.adobe.com/flashplayer/ adresinden indirinGiriş sayfasında nelerin görüntüleneceğini seçebilirsiniz. Yazıların zamana göre ters olarak sıralandığı (klasik blog) ya da sabit bir sayfa olabilir. Sabit bir giriş sayfası için ilk olarak iki sayfa oluşturmanız gerekir. Bunlardan biri giriş sayfasını, diğeri yazıları görüntülemek için kullanılır.%s dosyasını İnternet arayüzü ile oluşturabilirsiniz ama bu her sunucu kurulumunda çalışmayabilir. En garanti yol dosyayı sizin oluşturmanızdır.Özelleştirici içindeyken başka sayfalardaki bileşenleri görüntüleyip düzenlemek için o sayfalarda gezinebilirsiniz.Bu yazıya yapılmış tüm yorumları buradan görebilirsiniz:Bu yazıya eklenmiş tüm notları burada görebilirsiniz:Bu yazıya verilmiş tüm geri bağlantıları burada görebilirsiniz:Bu yazıya yapılmış tüm geri izlemeleri burada görebilirsiniz:Hesap açmak için bu e-posta adresini kullanamazsınız. Bu hizmetin WordPress tarafından gönderilen bazı e-postaları engellediği biliniyor. Lütfen başka bir e-posta hizmeti sağlayıcısı kullanın.Sıraya çok fazla sayıda dosya koymaya çalıştınız.Bu siteye eklendiniz. Lütfen <a href="%1$s">giriş sayfasına</a> gidin ya da kullanıcı adı ve parolanızla <a href="%2$s">oturum açın</a>.Oturum açtınız.%1$s blog arşivlerinde <strong>&#8216;%2$s&#8217;</strong> araması yaptınız. Herhangi bir sonuç bulamadıysanız aşağıdaki bağlantıları deneyebilirsiniz.Alan kotanızın tamamını kullandınız. Lütfen yükleme yapmadan önce bazı dosyaları silin.Yalnızca 1 dosya yükleyebilirsiniz.Yorum yapabilmek için <a href="%s">oturum açmalısınız</a>.Bir site oluşturabilmek için önce <a href="%s">oturum açmalısınız</a>.En az bir alıcı e-posta adresi belirtmelisiniz.Zamanlamak için gelecekteki bir tarihi belirtmelisiniz.Bu işlem için daha üst düzey bir izniniz olmalı.İlişkiye göre sıralamak için bir arama terimi belirtmelisiniz.Katılmaya göre sıralayabilmek için bir katma parametresi tanımlamalısınız.Yazı biçimleri parametresi olarak bir dizi aktarmalısınız.Türlerden oluşan bir dizi aktarmalısınız.Doğrulama için ilk parametreyi kullanarak bir işlem belirtmelisiniz.Kurulumunuz SFTP kimlik doğrulama bilgilerini gerektirdiğinden buradan yeni temalar kuramazsınız. Şimdilik temaları lütfen <a href="%s">yönetim bölümünden</a> ekleyin.Bir menü oluşturup, bir konuma atayacak, sayfa ve kategorilere bağlantılar vereceksiniz. Temanız birden çok menü alanını destekliyorsa, bu işlemi birkaç kez yapmanız gerekebilir.%1$s dosyanız %3$s yolu için dinamik bir değer (%2$s) kullanıyor. Ancak, %3$s yolundaki değer de dinamik bir değer (%4$s hedefini gösteriyor) ve başka bir dinamik değeri göstermesi desteklenmez. Lütfen %3$s yolunu doğrudan %4$s hedefini gösterecek şekilde güncelleyin.PHP kurulumunuzda WordPress'in çalışması için gerekli olan MySQL eklentisi eksik.Hesabınız etkinleştirildi. Seçmiş olduğunuz kullanıcı adı &#8220;%2$s&#8221; ile <a href="%1$s">oturum açabilirsiniz</a>. %3$s e-posta adresine parolanız ve oturum açma yönergeleri gönderildi. Henüz bir e-posta almadıysanız lütfen istenmeyen ya da çöp klasörlerine de bakın. Bir saat içinde bir e-posta almazsanız <a href="%4$s">parolanızı sıfırlayabilirsiniz</a>.Hesabınız etkinleştirildi. <a href="%1$s">Oturum açın</a> ya da <a href="%2$s">giriş sayfasına</a> dönün.Hesabınız etkinleştirildi. <a href="%1$s">Sitenizi görüntüleyin</a> ya da <a href="%2$s">oturum açın</a>Hesabınız şimdi etkin!Adresiniz %s olacak.BağlantılarınızTarayıcınız dosyaları karşıya yükleyemiyorTarayıcınız panoya doğrudan erişime izin vermiyor. Lütfen klavye kısayollarını ya da tarayıcınızın Düzenle menüsünü kullanın.Yorumunuz denetlenmeyi bekliyor.Yorumunuz denetlenmeyi bekliyor. Bu bir ön izlemedir. Yorumunuz onaylandıktan sonra görüntülenir.E-posta adresiniz henüz güncellenmedi. Lütfen onay e-postası için %s gelen kutunuzu kontrol edin.E-posta adresiniz yayınlanmayacak.Giriş sayfası görüntülenmesiSon yazılarınızNesne ön belleği uyarlamanız tek tek grupların temizlenmesini desteklemiyor.Nesne ön belleği uyarlamanız, bellek içi çalışma ön belleğinin temizlenmesini desteklemiyor.Parolanız sıfırlandı.Kaydınız ile ilgili e-posta bu adrese gönderildi. (İlerlemeden önce e-posta adresinizi iki kere kontrol edin.)Oturum süreniz dolmuş. Kaldığınız yerden ilerlemek için lütfen oturum açın.Siteniz %1$s adresinde etkin. Seçtiğiniz &#8220;%2$s&#8221; kullanıcı adını kullanarak sitenizde oturum açabilirsiniz. Parolanız ve oturum açma yönergeleri için lütfen %3$s e-postanızı kontrol edin. Henüz bir e-posta almadıysanız lütfen istenmeyen ya da çöp klasörlerini de kontrol edin. Bir saat içinde bir e-posta almazsanız <a href="%4$s">parolanızı sıfırlayabilirsiniz</a>.Sitenizin en güncel yazıları.Sitenizin en güncel yorumları.Temanız %s konumda menü görüntüleyebilir.Temanız %s konumda menü görüntüleyebilir.Temanız menüleri %s konumda görüntüleyebilir. Hangi menüyü kullanmak istediğinizi seçin.Temanız menüleri %s konumda görüntüleyebilir. Hangi menüyü kullanmak istediğinizi seçin.Temanız bir konumda menü görüntüleyebilir.Temanız menüleri tek bir yerde görüntüleyebilir. Hangi menüyü kullanmak istediğinizi seçin.Temanızda %s başka bileşen alanı var ancak bu sayfada görüntülenmiyor.Temanızda %s başka bileşen alanı var ancak bu sayfada görüntülenmiyorlar.Temanızda %s bileşen alanı var, ancak bu sayfada görüntülenmiyor.Temanızda %s bileşen alanı var, ancak bu sayfada görüntülenmiyorlar.Temanızda 1 başka bileşen alanı var ancak bu sayfada görüntülenmiyor.Temanızda 1 bileşen alanı var ancak bu sayfada görüntülenmiyor.Saat diliminiz %1$s (%2$s) olarak ayarlanmış, şu anda %3$s (Eşgüdümlü Evrensel Zaman %4$s).Saat diliminiz %1$s olarak ayarlanmış (Eşgüdümlü Evrensel Zaman %2$s)PHP sürümünüz, iletilerin bozulmasına neden olabilecek bir hatadan etkileniyor. Bunu düzeltmek için SMTP kullanarak göndermeye geçebilir, %2$s dosyanızdaki %1$s seçeneğini etkisizleştirebilir, macOS veya Linux kullanmaya geçebilir veya PHP sürümünüzü yükseltebilirsiniz.Zip dışa aktarma desteklenmiyor.[%1$s] İşlem onaylandı: %2$s[%1$s] Yorum: "%2$s"[%1$s] İşlemi onayla: %2$s[%1$s] Not: "%2$s"[%1$s] Geri bağlantı: "%2$s"[%1$s] Lütfen denetleyin: "%2$s"[%1$s] Geri izleme: "%2$s"[%s] Yönetici E-postası Değişti[%s] E-posta Değişikliği İsteği[%s] E-posta Değişti[%s] Silme isteği yerine getirildi[%s] Oturum açma bilgileri[%s] Ağ Yöneticisi E-posta Değişikliği İsteği[%s] Ağ Yöneticisi E-postası Değişti[%s] yeni site oluşturuldu[%s] Yeni bir kullanıcı hesap açtıParola değiştirildi [%s][%s] Parolayı Sıfırla[%s] sitenizde teknik bir sorun yaşanıyor["%s" modeli için blok oluşturma durduruldu][blok oluşturma durduruldu][silinmiş]İkinci parametre `$settings` için `boolean` türü kullanımdan kaldırıldı. Bunun yerine `array()` kullanın.bir günbir dakikabir aybir saniyebir yılBağlantıOrtamSayfaYazıSiteKullanıcıYeniMaviKahveVarsayılanEktoplazmaTazeAçıkGece yarısıOkyanusGün doğumuambir saat&#8217;%1$s %2$sYazar:OtomatikModel değiştirmeleriYazı verileriYazı üst verileriTerim verileriTasarımGömülülerOrtamModellerMetinTemaBileşenlerSitenizdeki yazıların takvimi.Her biri ne sıklıkta göründüğüne göre boyutlandırılmış, popüler anahtar kelimelerden oluşan bir bulut.Ziyaretçilerin sitenizde dolaşmasını sağlayan bir bloklar derlemesi.Kaplamaları kapatmak için özelleştirilebilir bir düğme.Sütun bloğunda tek bir sütun.Twitter ya da YouTube gibi diğer sitelerdeki içeriği görüntüleyen bir blok ekleyin.İndirilebilir bir dosyanın bağlantısını ekler.Gezinme menünüze bir sayfa, bağlantı ya da başka bir öge ekleyin.Gezinme menüsüne bir alt menü ekleyin.Kullanıcının avatarını ekle.Metin kaplaması ile bir görsel ya da video ekleyin.Özel HTML kodu ekleyin ve yazdıkça ön izleme yapın.Boşluk ve sekmelerinize uyumlu ve biçimlendirmenize de izin veren bir metin ekleyin.Bloklar arasına boş alan ekler ve yüksekliğini özelleştirir.Yazı yorumlarını farklı görsel yapılandırmaları ile görüntüleyen gelişmiş bir blok.Farklı sorgu parametrelerine ve görsel yapılandırmalara göre yazı türlerinin görüntülenmesini sağlayan gelişmiş bir blok.Farklı sorgu parametrelerine ve görsel yapılandırmalara göre sınıflandırma terimlerini görüntülemeyi sağlayan gelişmiş bir blok.Liste içindeki tek bir öge.Belirli bir sırada sergilenen ögelerin düzenlenmiş derlemesi.Yorumu görüntülemek için kullanılan, başlık, tarih, yazar, avatar ve diğer blok bileşenlerini içerir.Başlık, tarih, öne çıkarılmış görsel, içerik veya alıntı gibi bir yazıyı işlemek için kullanılan blok bileşenlerini içerir.Ad, açıklama ve diğer şeyler gibi bir sınıflandırma terimini görüntülemek için kullanılan blok bileşenlerini içerir.Herhangi bir sorgu sonucu bulunamadığında içeriği görüntülemek için kullanılacak blok bileşenlerini içerir.Başlığın altında gizli veya açık olan içeriği içerir.Bu bloktan önceki içerik, arşiv sayfanızdaki alıntıdan görüntülenir.Fikirler ya da bölümler arasında yatay bir ayraç ile bir aralık oluşturur.Her zaman sitenin giriş sayfasına işaret eden bir bağlantı oluşturun. Üst bilgide bir site başlığı bağlantısı varsa genellikle gerekli değildir.Bilgileri görüntülemek için satırlar ve sütunlar halinde yapılandırılmış içerik oluşturun.Bu sitenin ne ile ilgili olduğunu birkaç sözcükle açıklayın. Bu bilgi, arama sonuçları ve sosyal ağ paylaşımları için önemlidir ve ziyaretçilere genel bir bilgi sağlar.Geçerli sayfanın yolunu gösteren bir sayfa yolu görüntüler.Özel bir tarih görüntüler.Yazılarınızın arşivini görüntüler.Bir eski bileşeni görüntüler.Tüm sayfaların listesini görüntüler.Belirli bir sınıflandırmanın tüm terimlerinin listesini görüntüler.En güncel yorumlarınızın listesini görüntüler.Son yazılarınızın listesini görüntüler.Bir yazının yorum toplamını görüntüle.Bir yazının yorum formunu görüntüler.Yazının öne çıkarılmış görselini görüntüler.Sosyal ağ profiline ya da bir siteye bağlantı veren bir simge görüntüler.Bu siteyi temsil eden bir görsel görüntüleyin. Bu bloğu güncelleyin ve değişiklikler her yerde geçerli olsun.Boşluk ve sekmelerinize uyan kod parçaları görüntüler.İçeriği her sütuna bloklar ekleyerek çok sütunlu olarak görüntüler.Herhangi bir RSS veya Atom akışından gelen kayıtları görüntüler.Sayfaya eklenmiş alt bilgileri görüntüler.Sosyal ağ profillerinizin veya sitelerinizin bağlantı simgelerini görüntüler.Matematiksel gösterim için LaTeX kullanın.Zengin bir galeri içinde bir çok görsel görüntüler.Bir arşivi görüntülerken kategorilerin, etiketlerin ve özel sınıflandırmaların açıklamalarını görüntüleyin.Özeti görüntüler.Sorgu başlığını görüntüler.Bir sorgudaki toplam sonuç sayısını göster.İçeriği daraltılabilir bölümler halinde gruplayan katlanabilir bir yerleşim görüntüler.Akordeon panosunu açıp kapatan bir başlık görüntüler.WordPress yönetim bölümünde yorumu düzenlemek için bir bağlantı görüntüler. Bu bağlantı yalnızca yorum düzenleme yetkinliği olan kullanıcılar tarafından görülebilir.Bir yorumu yanıtlamak için bir bağlantı görüntüler.Yorum sayfalaması için sayfa numaralarının listesini görüntüler.Sayfalama için sayfa numaralarının listesini görüntüler.Bir sayfayı tüm sayfaların listesi içinde görüntüler.Kullanılabilir olduğunda, sonraki/önceki yorumlara giden, sayfalanmış bir gezinme menüsü görüntüler.Uygulanabildiğinde, sonraki/önceki yazı kümesi gezinmesi için sayfalamayı görüntüler.Yorum sayısının bulunduğu bir başlık görüntüler.Bir yorumun içeriğini görüntüler.Bir yazının ya da sayfanın içeriğini görüntüler.Yorumun gönderildiği tarihi görüntüler.Bir yazı, sayfa ya da herhangi başka bir içerik türünün bağlantısını görüntüler.Var olan yazı yorumlarının bağlantısını görüntüler.Bir sınıflandırma teriminin adını görüntüler.Yorumun yazarının adını görüntüler.Bu sitenin adını görüntüler. Bu bloğu güncellediğinizde yapılan değişiklikler kullanıldığı her yerde geçerli olur. Bu ad tarayıcı başlığında ve arama sonuçlarında da görüntülenir.Sonraki yorumun sayfa bağlantısını görüntüler.Geçerli yazıdan önceki ya da sonraki yazının bağlantısını görüntüler.Sonraki yazılar sayfa bağlantısını görüntüler.Bir sınıflandırma teriminin yazı sayısını görüntüler.Önceki yorumun sayfa bağlantısını görüntüler.Önceki yazılar sayfa bağlantısını görüntüler.Yazının, sayfanın veya başka bir içerik türünün başlığını görüntüler.Sitenizin üst bilgi, alt bilgi, kenar çubuğu gibi farklı genel bölümlerini düzenleyin ya da kendi bölümlerinizi oluşturun.Basit bir ses oynatıcı ekleyin.Ortam kitaplığınızdan bir video gömün ya da yeni bir tane yükleyin.Blokları bir yerleşim kapsayıcısında toplayın.Alıntılanmış metne görsel vurgu verin. "Başkalarından alıntı yaparken, kendimize atıfta bulunuruz." — Julio CortázarMetninizdeki bir alıntıya görsel vurgu uygular.Ziyaretçilerin içeriğinizi bulmalarına yardımcı olur.Ek içeriği gizler ve görüntüler.Bir WordPress kısa kodu ile başka özel bileşenler ekleyin.Bir SVG simgesi ekleyin.Görsel bir bildirim yapmak için bir görüntü ekler.Şiir ekleyin. Özel boşluk biçimleri kullanın. Ya da şarkı sözleri alıntılayın.İçeriğinizin yapısının ziyaretçileriniz (ve arama motorları) için daha anlaşılır kılmak için yeni bölümler ekleyin ve içeriği düzenleyin.Yazı terimleri.Ziyaretçilerden düğme biçeminde bir bağlantıyla işlem yapmalarını isteyin.Ziyaretçilerden düğme biçeminde bağlantı grubuyla işlem yapmalarını isteyin.Bu tasarım tüm sitede yeniden kullanılır.İçeriğinizi çoklu sayfa deneyimi ile ayırır.Daha zengin bir yerleşim için ortam ve sözcükleri yan yana getirir.Bir blok modelini görüntüler.Oturum açma ve kapatma bağlantılarını görüntüler.Yazıyı okumak için gereken süreyi gösterir. Sözcük sayısını da gösterebilir.Tüm anlatıların temel yapı taşıyla başlayın.Yazar biyografisi.Yazar adı.Bu blok kullanımdan kaldırıldı. Lütfen bunun yerine Avatar bloğunu, Yazar Adı bloğunu ve Yazar özgeçmişi bloğunu kullanın.Bu blok kullanım kaldırıldı. Lütfen bunun yerine Sütunlar bloğunu kullanın.Klasik WordPress düzenleyicisi kullanılsın.Başlığı ve panoyu tek bir birim halinde sarmalar.Siteniz bu bloğu desteklemiyor.arşivatomalıntıblogbloglarmadde imli listekategorileratıfkapatkapsayıcıözel yazı türleriaçıklamaaçıklamaayırıcıbelgeindirgömdenklemakışbulformformülyatay çizgihrsimgegörselgörsellergorsellatexbağlantıbağlantılarlisteoturum açmaçıkışşarkı sözlerimatematikmenüfilmmüzikgezinmesonraki sayfanumaralı listesıralı listekaplamasayfasayfalamapdffotoğraffotoğraflargörselpodcastşiirşiiryazılardevamını okuson yorumlarson yazılarkayıtbaşvurularyeniden kullanılabilirsatırbölümşarkıseskıtaalt başlıközetsvgetiketlersınıflandırmaterim başlığıterimlermetinbaşlıkaç/kapatdizevideosariciVarsayılanNoktalarDoldurYalnızca logolarÇevresi çizgiliHap şekliDüzYuvarlatılmışŞeritlerGeniş çizgiAkordeonAkordeon başlığıAkordeon ögesiAkordeon panosuArşivlerSesYazar (kullanımdan kaldırıldı)Yazar özgeçmişiYazar adıAvatarSayfa yollarıDüğmeDüğmelerTakvimKlasikKodSütunSütunlarYorum yazarı adıYorum içeriğiYorum tarihiYorum düzenleme bağlantısıYorum yanıtlama bağlantısıYorum şablonuYorumlarYorum toplamıYorum formuYorumlar bağlantısıYorumlar sonraki sayfaYorumlar sayfa numaralarıYorum sayfalamaYorumlar önceki sayfaYorumlar başlığıİçerikKapakÖzel HTMLÖzel bağlantıTarihAyrıntılarGömÖzetÖne çıkarılmış görselDosyaDipnotlarGaleriGrupBaşlıkGiriş bağlantısıSimgeGörselSon yorumlarSon yazılarEski bileşenListeListe ögesiOturum aç/kapatMatematikOrtam ve metinDaha fazlaGezinmeGezinme kaplamasını kapatSonraki sayfaSonuç yokSayfa sonuSayfa listesiSayfa listesi ögesiSayfa numaralarıSayfalamaParagrafModelModel yer belirticisiŞiirYazı gezinme bağlantısıYazı şablonuYazı terimleriÖnceden biçimlenmişÖnceki sayfaAlıntı yapSorgu döngüsüSorgu başlığıSorgu toplamıAlıntıRSSDevamını okuAraAyırıcıKısa kodSite logosuSite sloganıSite başlığıSosyal ağ simgesiSosyal ağ simgeleriAralayıcıAlt menüTabloEtiket bulutuŞablon parçasıTerim sayısıTerim açıklamasıTerim adıTerim şablonuTerimler listesiTerimler sorgusuMetin sütunları (kullanım dışı)Okuma süresiBaşlıkDesteklenmiyorVideoGereç grubu%s tarafından%1$s %2$sEn çok kullanılanKategori:kod imlerini kapat&#8221;&#8217;KoyuAçıkOnaylanmışİstenmeyenÇöpte20Arka planDaha önce yüklenenlerÖnerilenÜst bilgiZamanlaZamanlanmışj F YGün:Ay:Yıl:SonrakiÖncekioffSite varsayılanıetki alanı&#8243;Soldan sağaSağdan solaBlokları görüntüle&#8212;Site yönetimi&#8211;55&raquo;ArşivlerSes dosyasıVideoBulSonrakiÖncekiDeğiştirTümünü değiştirŞununla değiştirTüm sözcüklerDisplayEl yazısıMonospaceSans SerifSerifGoogle Fontstheme.json biçimindeki font-face ayarı. Dizge olarak kodlanmış.theme.json biçimindeki font-face ayarı.theme.json biçimindeki font-face ayarı.theme.json biçimindeki font-family ayarı. Dizge olarak kodlanmış.font_face_settings parametresi geçerli bir JSON dizgesi olmalıdır.H:iNisanAğustosAralıkŞubatOcakTemmuzHaziranMartMayısKasımEkimEylülYatay hizalamatrhttps://developer.wordpress.org/advanced-administration/debug/debug-network/https://developer.wordpress.org/advanced-administration/debug/debug-wordpress/https://developer.wordpress.org/advanced-administration/security/https/https://developer.wordpress.org/advanced-administration/wordpress/cookies/https://developer.wordpress.org/advanced-administration/wordpress/cookies/#enable-cookies-in-your-browserhttps://developer.wordpress.org/advanced-administration/wordpress/css/https://developer.wordpress.org/advanced-administration/wordpress/wp-config/https://developer.wordpress.org/reference/functions/is_main_query/https://developer.wordpress.org/themes/advanced-topics/child-themes/https://learn.wordpress.org/https://tr.wordpress.org/https://wordpress.org/documentation/https://wordpress.org/documentation/article/customize-permalinks/#choosing-your-permalink-structurehttps://wordpress.org/documentation/article/faq-troubleshooting/https://wordpress.org/documentation/article/manage-wordpress-widgets/https://wordpress.org/documentation/article/reset-your-password/https://wordpress.org/documentation/article/settings-general-screen/#email-addresshttps://wordpress.org/documentation/article/site-editor/https://wordpress.org/support/forum/requests-and-feedbackhttps://wordpress.org/support/forums/https://www.sitemaps.org/https://www.w3.org/WAI/tutorials/images/decision-tree/Aşağı okSola aşağı okSağa aşağı okSola okSağa okYukarı okSola yukarı okSağa yukarı okAt simgesi (@)SesZilBlok varsayılanıBlok üst verisiBlok tablosuTakvimFotoğraf çekVideo çekSepetKategoriDikkatGrafik çubuğuOnay işaretiAşağı VAşağı V küçükSola VSola V küçükSağa VSağa V küçükYukarı VYukarı aşağı VYukarı V küçükYorumKapakOluşturMasaüstüİndirSol çekmeceSağ çekmeceZarfHataDışDosyaGaleriGrupBaşlıkYardımGirişGörselBilgiAnahtarDilHarita işaretleyiciMenüMobilDaha yatayDaha dikeySonrakiParagrafÖdemeKalemKişilerArtıArtı daireÖncekiYayınlanmışAlıntıRSSMakbuzZamanlanmışAraAyarlarGölgePaylaşKalkanKarıştırBoş yıldızDolu yıldızYarım yıldızMağazaBiçemlerSimgeDolu simgeTabloTabletEtiketİpucuYükleDizeCtrl+K⌘Kl, j F YArama:Sonraki:Önceki:Ses ekleSes dosyasını düzenleSes dosyasını değiştirGörsel ekleGaleriyi düzenleGörsel ekleGörseli düzenleGörsel değiştirOrtam ekleOrtamı düzenleOrtamı değiştirVideo ekleVideoyu düzenleVideoyu değiştirÖzel...Kontrolleri gizleKontrolleri görüntüleSonrakiÖncekiTüm bağlantılarÇemberVarsayılanDiskKüçük alfaKüçük YunanKüçük RomanKareBüyük alfaBüyük romanhttps://wordpress.org/support/update-php/Video kaydını kaldırBenimEklenmemişMenüİşlemler(Şu anda ayarı: %s)(Şu anda: %s)(Bir menü <a href="%1$s" %2$s>bileşeni%3$s</a> kullanmayı düşünüyorsanız, bu adımı atlayın.)Bu menü burada görüntülenir. Bunu değiştirmek istiyorsanız başka bir konum seçin.Tüm konumları görüntüleKonumu görüntüleBu menünün nerede görüntülenmesini istersiniz?3(etiket yok)F Yçöpe atıldı.GirişKategoriye bir bağlantı.Sayfaya bir bağlantı.Yazıya bir bağlantı.Etikete bir bağlantı.Kategori bağlantısıSayfa bağlantısıYazı bağlantısıEtiket bağlantısıyeni WordPress döngüsüSonrakiSonrakiYorumSite simgesi ön izlemesiÇöpYükleme,.oEmbed yanıtıoEmbed yanıtlarıoEmbed (JSON)oEmbed (XML)/&#8220;&#8216;Öne çıkarılmış görselÖne çıkarılmış görseli kaldırÖne çıkarılmış görseli ayarlaÖne çıkarılmış görsel olarak kullan%1$s / %2$sParola uyuşmuyorOrtaParolanın zorluğu bilinmiyorGüçlüÇok zayıfZayıfAra &hellip;&#8220;%s&#8221;pmÖne çıkarılmış görselÖne çıkarılmış görseli kaldırÖne çıkarılmış görseli ayarlaÖne çıkarılmış görsel olarak kullanBiçimBiçimlerYan sütunSesSohbetlerGalerilerGörsellerBağlantılarAlıntılarDurumlarVideolarGirişTaslakOnay bekliyorÖzelYayınlandıZamanlandıÇöpteArşivler:Değişim kümelerlGenel biçemlerOrtamGezinme menüleriSayfalarModellerYazılarŞablon parçalarıŞablonlarDeğişim kümesiGezinme menüsüSayfaModelYazıŞablonŞablon parçasıÖncekiÖnceki&#8242;benzersiz ifadenizi buraya koyunTamamlandıOnaylandıBaşarısız olduBekleyençözümlendi/yeniden açıldıj F Y @ H:i:s&larr; %s sitesine gitsiteadi500pxAmazonBandcampBehanceBlueskyCodePenDeviantArtDiscordDribbbleDropboxEtsyFacebookFlickrFoursquareGitHubGodreadsGoogleGravatarInstagramLast.fmBağlantıLinkedInE-postaMastodonOrtaMeetupPatreonPinterestPocketRSS akışıRedditPaylaşım İmajıSkypeSnapchatSoundCloudSpotifyTelegramThread (iş parçacığı) sayısıTikTokTumblrTwitchTwitterVKVimeoWhatsAppWordPressXYelpYouTubeBitirYok sayTümünü yok sayalt ögeAraVücutHücreHiçbiriKapsamAlt bilgiBaşlıkEtiket:,En çok kullanılanKategorilerModel kategorileriEtiketlerKategoriModel kategorisiEtiket%s arşivleri%s:Alt bilgiGenelÜst bilgiGezinme kaplamasımetin yönültr<strong>Hata:</strong> Geçerli PHP sürümü en düşük %s gereksinimlerini karşılamıyor.<strong>Hata:</strong> Geçerli WordPress ve PHP sürümleri, en düşük %s gereksinimlerini karşılamıyor.<strong>Hata:</strong> Geçerli WordPress sürümü %s için en düşük gereksinimleri karşılamıyor.%s temasını etkinleştirDeğiştirKuruluÖn izleme:Geliştirici: %sKullanılabilirKuruluBEBGBKBMBPBTBYBZB%s yazısının başlığı yok%1$s (%2$s)ÖnizlemeYanıtlaÇöpYükleDikey hizalamaSüre%2$s için %1$sY… <a class="wp-block-latest-posts__read-more" href="%1$s" rel="noopener noreferrer">Ayrıntılı bilgi alın<span class="screen-reader-text">: %2$s</span></a>

Youez - 2016 - github.com/yon3zu
LinuXploit